Wikipedia:Deletion log Archive for October 2002 (936 deletions)
- 22:08 Oct 31, 2002 Maveric149 deleted "Computer keyboard" (just a redirect page -- need to get this out of the way for a move)
- 20:47 Oct 31, 2002 Tarquin deleted "Solar tower" (no content)
- 15:55 Oct 31, 2002 Jheijmans deleted "Modern Pentathlon at the 1936 Summer Olympics" (\"Which male won the 100 and 200 meter gold medals?\")
- 09:43 Oct 31, 2002 Magnus Manske deleted "Saint-Cyr" (Says \"Cyr = Cyriacus Quiriacus = Quiricus\")
- 08:46 Oct 31, 2002 Magnus Manske deleted "Data storage" (newbie experiment)
- 08:11 Oct 31, 2002 Jheijmans deleted "Liar (short story)" (what)
- 08:11 Oct 31, 2002 Jheijmans deleted "Sumerian Early Dynastic period" (you all suck)
- 08:10 Oct 31, 2002 Jheijmans deleted "Analog first generation" (Put your text for the new page here. FHFHFHFH)
- 08:10 Oct 31, 2002 Jheijmans deleted "Automaton" (hello how are u)
- 08:10 Oct 31, 2002 Jheijmans deleted "State diagram" (abUababa)
- 08:10 Oct 31, 2002 Jheijmans deleted "Talk:2209" (talk of delete dpage)
- 08:10 Oct 31, 2002 Jheijmans deleted "2209" (\"hola nietos , espero q esten q esten bien , y el sida no sea problema , fernando lopina buenos aires octubre del 2002\")
- 08:09 Oct 31, 2002 Jheijmans deleted "Turing reduction" (\"Wikipedia (n): 1) Wikipedia derives its meaning from the Greek words \"Wiki\", meaning \"The\", and \"pedia\" meaning \"Free Encyclopedia.\" How these two unrelated words were combined into \"Wikipedia\" remains lost in the annals of time.\")
- 08:09 Oct 31, 2002 Jheijmans deleted "Kitakyushu" (\"Put your text for the new page here. \'\")
- 08:08 Oct 31, 2002 Jheijmans deleted "Fraser River" (\"Put your text for the new page here. this web site sux a$$\")
- 08:08 Oct 31, 2002 Jheijmans deleted "La Cliqua" (\"Put your text for the new page here. Hello all. I need some good music for my really boring French2 class. My teacher said we could get something a little more \"hip. Get me some sik beats! Merci. Musique fableaux! Tres chic et neveau.\")
- 08:07 Oct 31, 2002 Jheijmans deleted "Ad hoc protocol list" (\"Some of the existing protocols:\")
- 07:37 Oct 31, 2002 JeLuF deleted "Sir Andrew Ramsay" (Content: \"he was cool\", 172.164.123.242)
- 07:37 Oct 31, 2002 JeLuF deleted "Synonymy" (Content: \"abdi jumped the window\", 137.111.13.32)
- 06:48 Oct 31, 2002 Sjc deleted "Peter Tosh" (This page is unsavable when edited. Bug report submitted.)
- 05:32 Oct 31, 2002 Brion VIBBER deleted "Christian Dior" (Garbage by 64.166.108.167; only text \"fucking loser\")
- 05:22 Oct 31, 2002 Maveric149 deleted "Rhenium/Temp" (temp page that is no longer needed)
- 03:36 Oct 31, 2002 PierreAbbat deleted "Richard Leakey" (newbie experiment by 208.224.150.138: \"he is cool\")
- 23:58 Oct 30, 2002 PierreAbbat deleted "Charles's law" (low-entropy junk by 152.163.188.2: \"AAAAAAA\"...)
- 22:55 Oct 30, 2002 The Epopt deleted "Agosta 90B class submarine" (deletion of redirect to allow move)
- 20:36 Oct 30, 2002 JeLuF deleted "Olde Cheshire Cheese (London pub)" (Content: \"Metta il vostro testo per la nuova pagina qui.prpducco formaggio staggionato con pezzi di vemi,è un formaggio a base di latte del toro \", 80.206.239.230)
- 20:35 Oct 30, 2002 JeLuF deleted "Top-down" (Content: \"Put your text for the new page here. gfsgs\", 128.211.249.253)
- 20:34 Oct 30, 2002 JeLuF deleted "Nearest neighbor algorithm" (Content: some hundred random characters, 211.72.158.234)
- 20:33 Oct 30, 2002 JeLuF deleted "Dog whistle" (Content: \"sfsfsdgggs\", 142.22.16.54)
- 20:32 Oct 30, 2002 JeLuF deleted "Sforzando" (Content: \"Put your text for the new page here. yeah, whatever \", 208.32.128.10)
- 18:57 Oct 30, 2002 Tarquin deleted "BLT sandwitch" (mispeeling)
- 18:56 Oct 30, 2002 Tarquin deleted "BLT sandwich" (making way)
- 18:54 Oct 30, 2002 Tarquin deleted "Club sandwich" (no content)
- 15:51 Oct 30, 2002 Tarquin deleted "N'Djamena" (212.219.189.245 -- go home)
- 15:50 Oct 30, 2002 Ed Poor deleted "Renaming page, as suggested" (completing move)
- 15:46 Oct 30, 2002 Tarquin deleted "WikiWiki)" (daft title)
- 15:37 Oct 30, 2002 Magnus Manske deleted "WikiWiki)" (newbie test)
- 12:52 Oct 30, 2002 Brion VIBBER deleted "CMOS Memory" (Newbie experiment; \"Put your text for the new page here. are you kidding me?\")
- 12:14 Oct 30, 2002 Tarquin deleted "Nipple piercing" (junk entry. Hey, it\'d be a junk entry no matter *what* people wrote here. Wikipedia does not encourage self-mutilation, blah blah)
- 10:50 Oct 30, 2002 Jheijmans deleted "De Witt Clinton" (empty, prev \"what? i don\'t want to edit, i want to read...this isn\'t helping me with m term paper...\")
- 10:50 Oct 30, 2002 Jheijmans deleted "Preda Mihailescu" (empty, prev \"Poos\")
- 10:50 Oct 30, 2002 Jheijmans deleted "When it Happens" (\"When It Happens, by Margaret Atwood\")
- 10:49 Oct 30, 2002 Jheijmans deleted "Mossel Bay" (empty, prev \"Put your text for the new page here. what exactly is Mossel Bay?\")
- 04:32 Oct 30, 2002 Brion VIBBER deleted "Zu Chen" (Garbage by 203.166.47.226; only content \"she is silly\")
- 04:32 Oct 30, 2002 Brion VIBBER deleted "Jun Xie" (Garbage by 203.166.47.226; only content \"she is dum\")
- 01:28 Oct 30, 2002 PierreAbbat deleted "Henri Désiré Landru" (garbage by 64.12.96.102: \"u are abasshole\", since deleted)
- 23:10 Oct 29, 2002 Brion VIBBER deleted "Mercury-in-glass thermometer" (\"Put your text for the new page here.uufifki , t 9i 8rg ij trj ju j jrttjj j 5ju jt ujutjuijuf0 ij ijjjjjj i0 9i juj j ju ju j u8juj 90 ij 0j8 vuiujfhuyi j u8hfooj guity tryt rgrrg.\")
- 23:01 Oct 29, 2002 PierreAbbat deleted "Thylakoid" (nonsense by 24.197.134.228: \"dskfudfsg\")
- 22:54 Oct 29, 2002 PierreAbbat deleted "Image:Vaag.JPG" (Junk image. Some screen in Dutch showing the epoch as an erroneous time, circled.)
- 21:26 Oct 29, 2002 Jheijmans deleted "Edit" (empty, bullshit before)
- 21:26 Oct 29, 2002 Jheijmans deleted "Tramping" (\"New Zealand epxression for hiking.\")
- 20:20 Oct 29, 2002 JeLuF deleted "Lloyd Bentsen" (Content: \"Put your text for the new page here. Lloyd I love You \")
- 19:21 Oct 29, 2002 Tarquin deleted "Harry Potter and the Order of the Phoenix" (go home kids)
- 17:32 Oct 29, 2002 Ed Poor deleted "Moscow theatre siege" (make room for move)
- 13:59 Oct 29, 2002 Brion VIBBER deleted "Hitler: The Last Ten Days" (Garbage, no history; only content \"he had sex with his dog\". (156.63.205.5))
- 13:52 Oct 29, 2002 Brion VIBBER deleted "Battle of Otford" (Only content \"Put your text for the new page here. THE BATTLE OF OTFORD IS STILL ONGOING, I HAVE A BATTLE TO PARK MY CAR EVERY TIME I GO THERE\" - moved to Bad jokes and other deleted nonsense page)
- 13:31 Oct 29, 2002 Brion VIBBER deleted "Talk:Hafez al-Assad" (Garbage; only content \"he gave good head\")
- 13:30 Oct 29, 2002 Brion VIBBER deleted "Image talk:Hitler.jpg" (Garbage; only content \"he was a gay fucker\")
- 13:27 Oct 29, 2002 Brion VIBBER deleted "Sukarno" (Garbage; only content \'he liked getting fucked in the ass. He had a homosextual boyfriend named kyle rooney. they had sex all the time.\')
- 13:26 Oct 29, 2002 Brion VIBBER deleted "Suharto" (No history; only content \"eat my dick\")
- 11:26 Oct 29, 2002 Karen Johnson deleted "X/Open" (one sentence stub does not relate to the title)
- 10:00 Oct 29, 2002 Karen Johnson deleted "Peasant rebellion" (empty orphaned list)
- 09:53 Oct 29, 2002 Karen Johnson deleted "University of Birmingham" (you may loooove the uni, but that\'s not an article)
- 09:51 Oct 29, 2002 Karen Johnson deleted "Dictionary of the Norwegian Dialects" (hei)
- 09:14 Oct 29, 2002 Brion VIBBER deleted "St. Paul's Cathedral" (No history; only content \"Pigs fly!!!\")
- 07:52 Oct 29, 2002 Jheijmans deleted "Bob Kane" (\"Co-creator of Batman.\")
- 07:13 Oct 29, 2002 JeLuF deleted "Pi-calculus" (Content: \"Mostly harmless\")
- 07:13 Oct 29, 2002 JeLuF deleted "Dwarf elliptical galaxy" (Content: \"This is a NEW PAGE -Do you like it????????????? \")
- 05:23 Oct 29, 2002 AxelBoldt deleted "Post system" (the contents \"erttywedsfgsdfgertg \" did not quite match expectations)
- 04:21 Oct 29, 2002 Koyaanis Qatsi deleted "Image:Aalayout.jpg" (some big (700 k card professing love for somebody, unused in any article))
- 03:27 Oct 29, 2002 PierreAbbat deleted "0001 B.C." (junk by 64.12.96.106. What\'s a \"poochi-wa\"?)
- 03:24 Oct 29, 2002 PierreAbbat deleted "Talk:Hydroelectricity" (junk by 24.76.80.198: \"sup\")
- 03:23 Oct 29, 2002 PierreAbbat deleted "Archaism" (mere def by 80.37.58.169: \"Use of an ancient word.\")
- 03:09 Oct 29, 2002 Karen Johnson deleted "Image:Marigoldthumbnail.pg.jpg" (mistaken identity)
- 03:07 Oct 29, 2002 Karen Johnson deleted "Mechanical energy" (vandalism)
- 03:06 Oct 29, 2002 Karen Johnson deleted "Breach of contract" (Ask Professor Kinsfield.)
- 03:06 Oct 29, 2002 Karen Johnson deleted "Isolating language" (things to be believed in)
- 03:05 Oct 29, 2002 Karen Johnson deleted "Gush Shalom" (shalom)
- 03:05 Oct 29, 2002 Karen Johnson deleted "Push-down automaton" (junk)
- 03:04 Oct 29, 2002 Karen Johnson deleted "Morrill act" (om)
- 01:03 Oct 29, 2002 Tarquin deleted "OMW" (junk entry)
- 19:43 Oct 28, 2002 JeLuF deleted "Free Software movement" (Content: \"this is my test page for compressing a text file using Lempel ziv compressio algorithm \")
- 18:23 Oct 28, 2002 Jheijmans deleted "Fabio" (\"im the hero\")
- 18:22 Oct 28, 2002 Jheijmans deleted "Application server" (\"AHMED\")
- 15:56 Oct 28, 2002 Ed Poor deleted "Unification Church and anti-Semitism" (making room for a \"Move\")
- 15:49 Oct 28, 2002 Tarquin deleted "Cut in" (junk entry)
- 14:12 Oct 28, 2002 Jheijmans deleted "Rembrandt" (needed for move - just a redirect)
- 12:51 Oct 28, 2002 Magnus Manske deleted "Asian crisis" (Says \" test test2\")
- 08:10 Oct 28, 2002 Maveric149 deleted "Nonviolence" (See ahimsa. = not an article)
- 07:53 Oct 28, 2002 Jheijmans deleted "Andorra la Vella" (redirect, needed for a move)
- 06:51 Oct 28, 2002 Karen Johnson deleted "Mitochondrial membrane" (I don\'t care if you want to learn more about cells - do your own research)
- 06:40 Oct 28, 2002 Karen Johnson deleted "Michigan Rummy" (vandalism)
- 06:10 Oct 28, 2002 Karen Johnson deleted "The war against Reform and Conservative Judaism" (article moved to talk pending removal entirely)
- 06:03 Oct 28, 2002 Koyaanis Qatsi deleted "David Matthews" (Put your text for the new page here.
V‚µ‚¢ƒy[ƒW‚Ì‚ ‚È‚½‚̃eƒLƒXƒg‚ð‚±‚±‚Å’u‚¢‚Ä‚‚¾‚³‚¢B )
- 05:50 Oct 28, 2002 Karen Johnson deleted "Demagoguery" (\'what is demagoguery? A pejorative synonym for demagogy)
- 05:47 Oct 28, 2002 Karen Johnson deleted "Motor coil resistance" (experiment)
- 05:40 Oct 28, 2002 Karen Johnson deleted "Hollywood Babylon" (Holly Wood Babylon is a book. - until someone can be more specific we don\'t need this!)
- 05:40 Oct 28, 2002 Karen Johnson deleted "Tax evasion" (i asked you weedo)
- 05:39 Oct 28, 2002 PierreAbbat deleted "Progenote" (Wikipedia is not a dictionary: \"universal ancestor\")
- 05:39 Oct 28, 2002 Karen Johnson deleted "Progenote" (universal ancestor )
- 05:38 Oct 28, 2002 Karen Johnson deleted "Tollund" (several generations of garbage!)
- 05:37 Oct 28, 2002 Karen Johnson deleted "Meet in the middle" (Hi I Am A Man.)
- 05:26 Oct 28, 2002 PierreAbbat deleted "Lock and key" (nonsense by 65.95.156.177: \"Put your text for the new page here. ff fdskjt fkdst eif dfjfj dflkjdsfsdf\")
- 02:53 Oct 28, 2002 Maveric149 deleted "Spindle" (spindle )
- 02:24 Oct 28, 2002 Karen Johnson deleted "Talk:Mystery" (the day for this self-advertisment is done... )
- 01:13 Oct 28, 2002 Isis deleted "Image:Tartan.PNG" (we\'re done talking about it)
- 00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg" (Wrong name)
- 00:58 Oct 28, 2002 Maveric149 deleted "Image:Tour group entering South Portal of Yucca Mountain.jpg" (It\'s the /North/ Portal)
- 22:58 Oct 27, 2002 PierreAbbat deleted "Colouring algorithm" (nonsense by 131.238.116.232: \"Put your text for the new page here. sadasdasdasd\")
- 22:04 Oct 27, 2002 Jheijmans deleted "Frederick II of Naples" (empty, prev \"moo\")
- 21:10 Oct 27, 2002 Jheijmans deleted "Shopping mall" (\"Shopping center. The place/building where several stores are located. \")
- 20:20 Oct 27, 2002 Scipius deleted "Estonia/Temp" (Temp page no longer necessary)
- 19:45 Oct 27, 2002 JeLuF deleted "Black widow spider" (Content: \"Fuck that shit \")
- 19:37 Oct 27, 2002 Maveric149 deleted "Fort Garry" (ddfkld\' )
- 17:17 Oct 27, 2002 JeLuF deleted "Fluorescent light" (Content: \"Sup Dawgs \")
- 17:15 Oct 27, 2002 JeLuF deleted "Rollie Fingers" (Content: \" Put your text for the new page here. he is a penis eater \")
- 17:13 Oct 27, 2002 JeLuF deleted "Dogrib" (Content: \"The dogribs ate dog and wolf ribs! \")
- 17:06 Oct 27, 2002 JeLuF deleted "Page Widening" (Content: \"Slashdot sucks! \")
- 14:28 Oct 27, 2002 Magnus Manske deleted "Image:Soldierwithwings thumb.htm" (crap ;-))
- 12:31 Oct 27, 2002 Jheijmans deleted "User:Jheijmans/Zandbak" (some testing...)
- 12:03 Oct 27, 2002 Jheijmans deleted "Quantum dot computer" (\"Put your text for the new page here. dfd \")
- 12:02 Oct 27, 2002 Jheijmans deleted "Joel David Bondurant" (\"Famous mathematician and physicist. \")
- 12:01 Oct 27, 2002 Jheijmans deleted "Kassubian" (\"FUCK THE GODDAMN SLAVS!!! \")
- 08:34 Oct 27, 2002 JeLuF deleted "Goddess of Democracy" (Content:\" <A class=encyclopedia href=\"http://www.google.com\">hi</A> \")
- 07:41 Oct 27, 2002 Maveric149 deleted "John Wilkins" (Put your text for the new page here. John Wilkins )
- 03:13 Oct 27, 2002 Brion VIBBER deleted "Basidium" (by 63.20.117.149 -- no history, only content \"u dont know shit do u? NNNNOOOOOO!!\")
- 03:09 Oct 27, 2002 Brion VIBBER deleted "Espionage Act" (Non-article; only content \"The Espionage Act sucked and so did Palmer! Did you know that people can have sex all day every 30 mins?\")
- 02:34 Oct 27, 2002 PierreAbbat deleted "Eurpoean" (title is misspelled)
- 01:10 Oct 27, 2002 PierreAbbat deleted "Talk:Francesco Andreini" (newbie experiment by 68.44.116.247: only content \"Hello\")
- 22:04 Oct 26, 2002 Maveric149 deleted "User:194.117.133.196" (Vandal page)
- 21:58 Oct 26, 2002 Maveric149 deleted "Hilary rosen" (result of vandalism)
- 21:57 Oct 26, 2002 Maveric149 deleted "Excrement" (result of vandalism)
- 21:57 Oct 26, 2002 Maveric149 deleted "Contructophobia" (stub. )
- 21:56 Oct 26, 2002 Maveric149 deleted "0o0o0o0o0o0o0o0o0o0" (result of vandalism)
- 21:55 Oct 26, 2002 Maveric149 deleted "WikiWikiWikiWiki" (result of vandalism)
- 21:05 Oct 26, 2002 Maveric149 deleted "Greek Orthodox" (ee also under \"Suzy Khimm\". )
- 20:01 Oct 26, 2002 Danny deleted "Hormizd II of Persai" (typo in title)
- 18:56 Oct 26, 2002 Scipius deleted "Jules Bonnot" (Full text: \"sgh ahe \" (Edit Comment: ehhr))
- 15:17 Oct 26, 2002 Jheijmans deleted "Zacharias Janssen" (\"hi\")
- 15:16 Oct 26, 2002 Jheijmans deleted "Krankenhaus" (there\'s no need for redirects in German for normal English words)
- 15:15 Oct 26, 2002 Jheijmans deleted "Mayan hieroglyph" (\"karlisha ladawn monday \")
- 15:15 Oct 26, 2002 Jheijmans deleted "MIPS architecture/Instructions" (\"gjkhj \")
- 15:14 Oct 26, 2002 Jheijmans deleted "PC-DOS" (\"kij\")
- 14:15 Oct 26, 2002 Jheijmans deleted "China/Temp" (temporary page)
- 12:52 Oct 26, 2002 Jheijmans deleted "Ancient Roman eschatology" (empty, prev \"nice\")
- 12:52 Oct 26, 2002 Jheijmans deleted "Albert Luthuli" (empty, prev \" opgreLNÑ<N PEJNR wpj´mpo OPJ54W GWrou IOPNE ipoengklrek giopingre v9int n lh t3hioht\")
- 12:09 Oct 26, 2002 JeLuF deleted "Matabele" (Content: \"????\")
- 07:18 Oct 26, 2002 JeLuF deleted "Mars bar" (Content: \"Put your text for the new page here.adsasdasd\")
- 07:17 Oct 26, 2002 JeLuF deleted "IEEE 802.10" (Content: \"IEEE 802.10\")
- 05:18 Oct 26, 2002 The Cunctator deleted "Image:Paul Wellstone.jpg" (Not nec. public domain. I uploaded it.)
- 22:41 Oct 25, 2002 Ed Poor deleted "Talk:Ded reckoning" (page was moved -- nothing links here)
- 22:09 Oct 25, 2002 JeLuF deleted "Mo Vaughn" (Content: \"Again, how we can forget Chili Davis?? \")
- 22:08 Oct 25, 2002 JeLuF deleted "Wally Joyner" (Content: \"what about Chili Davis?? \")
- 21:03 Oct 25, 2002 JeLuF deleted "Mark Shuttleworth" (Content was random noise)
- 21:00 Oct 25, 2002 JeLuF deleted "Portal circulation" (Content: \"Put your text for the new page here. anastomosis porto-cava \")
- 20:51 Oct 25, 2002 JeLuF deleted "Random number generator" (Content: \"i don\'t want anything from you. just tell me what i told you before. \")
- 20:13 Oct 25, 2002 Tarquin deleted "Babylonian numerals" (junk entry)
- 19:16 Oct 25, 2002 Sjc deleted "User:193.251.9.132 is back for more" (Vandalism)
- 19:15 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg" (goatse image from 193.251.9.132 is back for more)
- 19:15 Oct 25, 2002 Sjc deleted "Image:Hello.jpg" (Vandalism)
- 19:12 Oct 25, 2002 Koyaanis Qatsi deleted "Image:Widening" (not an image but text: \"It tastes like chicken, only with secret sause!\")
- 19:01 Oct 25, 2002 Koyaanis Qatsi deleted "Wikipedia:Ram-man" (\"um, yes, i spam wikipedia with useless autogenerated pages of US villages that no one gives a flying fuck about, please block me. I am insane! \" -- more from 193.251.9.132)
- 18:49 Oct 25, 2002 Sjc deleted "Klerckistheuberleetpagewidening-g0d-he-is-a-true-hax0r-he-forces-cmdrtaco-to-eat-feaces-because-he-is-sofucking-great-i-wonder-how-long-i-can-make-a-subject-be-fore-wikipedia-fux0rz-up-or-before-mozilla-does-it-probably-can-go-on-for-fucking-forever-if-i-" (Completely irredeemable nonsense. Amusing title nevertheless.)
- 18:43 Oct 25, 2002 Koyaanis Qatsi deleted "Klerckistheuberleetpagewidening-g0d-he-is-a-true-hax0r-he-forces-cmdrtaco-to-eat-feaces-because-he-is-sofucking-great-i-wonder-how-long-i-can-make-a-subject-be-fore-wikipedia-fux0rz-up-or-before-mozilla-does-it-probably-can-go-on-for-fucking-forever-if-i-" (Klerck, you are so l33t, i LOVE Page widening. g to the oatse c to the issex you are so fucking cool that i SHAT my pantx0rz )
- 18:29 Oct 25, 2002 Jheijmans deleted "Path integral" (\" The amount of hamburgers one man can eat in a day.\")
- 18:29 Oct 25, 2002 Jheijmans deleted "Statistical distribution" (\"Put your text for the new page here.extreme value \")
- 18:28 Oct 25, 2002 Jheijmans deleted "Precious metal" (\"Precious metals include gold, platinum, and silver. \"\")
- 18:26 Oct 25, 2002 Jheijmans deleted "Joel David Bondurant" (\"A famous american mathematician. \")
- 18:26 Oct 25, 2002 Jheijmans deleted "Buffalo Bill" (\"alias William Frederick Cody \")
- 18:26 Oct 25, 2002 Jheijmans deleted "Phylogenetic tree" (\" this is retarded \")
- 18:26 Oct 25, 2002 Jheijmans deleted "Residue" (\"Chewing Tobacco \")
- 18:25 Oct 25, 2002 Jheijmans deleted "Distance-vector routing protocol" (\" helloooooooooooo \")
- 18:25 Oct 25, 2002 Jheijmans deleted "Concordance" (empty, prev \" Put your text for the new page here. genitive \")
- 18:22 Oct 25, 2002 Jheijmans deleted "Cross-country running" (\"Emily\")
- 18:21 Oct 25, 2002 Jheijmans deleted "Royal Tombs of Ur" (\"u suck \")
- 18:21 Oct 25, 2002 Jheijmans deleted "Pictograph" (\"damion\")
- 18:21 Oct 25, 2002 Jheijmans deleted "Allotheria" (\"allotheria\")
- 18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation" (empty, prev \" http://www.duicenter.com/ \")
- 18:21 Oct 25, 2002 Jheijmans deleted "Retrograde extrapolation" (empty, prev \" http://www.duicenter.com/ \")
- 18:20 Oct 25, 2002 Jheijmans deleted "Cape Fear" (empty, prev \"Put your text for the new page here. the cape fear \")
- 18:20 Oct 25, 2002 Jheijmans deleted "Pierre Sauvignon de Brazza" (empty, prev \"picture\")
- 15:50 Oct 25, 2002 Andre Engels deleted "Sulfide" (misnamed page, was about copper sulfides rather than sulfides in general; page and history moved to copper sulfide)
- 15:48 Oct 25, 2002 Andre Engels deleted "Cupper sulfide" (moved to wrong title; contents and history moved to copper sulfide)
- 09:35 Oct 25, 2002 Magnus Manske deleted "Markov algorithm" (just created, empty)
- 08:47 Oct 25, 2002 Karen Johnson deleted "Mahmud I" (garbage - the wikipedia is not a homework completion service)
- 00:27 Oct 25, 2002 Koyaanis Qatsi deleted "Locro" (Hey, my homies, wazzup? If u wanna be a hot chica go to ecuador where you can get tan and lean form the beaches and stuff... )
- 00:26 Oct 25, 2002 Koyaanis Qatsi deleted "Marching music" (Rach D smells )
- 21:18 Oct 24, 2002 JeLuF deleted "On-Line Medical Dictionary" (Former content: \"http://cancerweb.ncl.ac.uk/omd/ \", now empty)
- 21:17 Oct 24, 2002 JeLuF deleted "Bureau of Standards" (Content: \"Put your text for the new page here. wahaha \")
- 21:16 Oct 24, 2002 JeLuF deleted "Frozen Four" (Content: \"this game rocks my dick \")
- 21:15 Oct 24, 2002 JeLuF deleted "The Fall of the House of Usher" (Content: \"Hi i like eggs \")
- 21:13 Oct 24, 2002 JeLuF deleted "Minbar" (Content: \"Hull middle from duluth, Georgia rocks! \")
- 21:13 Oct 24, 2002 JeLuF deleted "John Purroy Mitchel" (Content: random noise)
- 21:12 Oct 24, 2002 JeLuF deleted "FFS" (Content: \"editing ffs\")
- 18:50 Oct 24, 2002 The Cunctator deleted "Talk:Beltway Sniper" (same as subject page.)
- 18:49 Oct 24, 2002 The Cunctator deleted "Beltway Sniper" (Moving back to singular. Only one sniper.)
- 17:26 Oct 24, 2002 Ed Poor deleted "Keep on trollin trollin trollin" (graffiti)
- 17:23 Oct 24, 2002 Koyaanis Qatsi deleted "Image:Hello.jpg" (goatse image)
- 14:08 Oct 24, 2002 Jheijmans deleted "Sunne" (needed for another page, is redirect)
- 13:42 Oct 24, 2002 Jheijmans deleted "-lvsbyn" (accidentally created by me)
- 13:14 Oct 24, 2002 Jheijmans deleted "Berg" (needed for another page, redirect to Alban Berg (not used))
- 08:01 Oct 24, 2002 Koyaanis Qatsi deleted "THX 1138:4EB" (Put your text for the new page here. hi )
- 07:42 Oct 24, 2002 Jheijmans deleted "Rustler's knot" (\"instructions for tying a rustler\'s knot\")
- 07:41 Oct 24, 2002 Jheijmans deleted "Duotrigintillion" (\"Put your text for the new page here.\")
- 07:41 Oct 24, 2002 Jheijmans deleted "Mudhoney" (empty, prev \"Mudhuney sucks.\")
- 07:40 Oct 24, 2002 Jheijmans deleted "Geheimfernschreiber" (empty, prev \"This is a test of the geheimfernschreiber code used by nazis in 1943. This test will be used in a report by Craig Warren in a report for praxis module year 1 computer science, Heriot Watt University.\")
- 07:40 Oct 24, 2002 Jheijmans deleted "Projection" (empty, prev \"Put hfgh\")
- 07:40 Oct 24, 2002 Jheijmans deleted "Channel 5/UK" (empty, prev \"Put your text for the new page here. rah\")
- 06:54 Oct 24, 2002 Brion VIBBER deleted "Simon peters" (Non-article; only content \"simon peters was found being gay with a boy nnamed andy collalo\")
- 04:07 Oct 24, 2002 Brion VIBBER deleted "Waring's problem" (Cut-n-paste from Warings problem. Need to delete it to make room for a proper rename of the article with history intact)
- 03:08 Oct 24, 2002 Brion VIBBER deleted "Propaganda/Slogans" (Non-article; only content \"Put your text for the new page here. asdasdasd\")
- 00:02 Oct 24, 2002 Lee Daniel Crocker deleted "Fred Olsen" (Similar random vandal page-creation.)
- 00:00 Oct 24, 2002 Lee Daniel Crocker deleted "James Rosenquist" (No content, no history, random vandal.)
- 23:22 Oct 23, 2002 Lee Daniel Crocker deleted "Minoan civilization" (Preparing for move)
- 22:26 Oct 23, 2002 Brion VIBBER deleted "Logging file system" (Non-article; only content \"???????\")
- 21:08 Oct 23, 2002 Brion VIBBER deleted "Bloomingberg, ohio" (More goatse.cx)
- 20:44 Oct 23, 2002 Brion VIBBER deleted "Wikipedia:VANDALISMS IN PROGRESS" (More goatse.cx)
- 20:34 Oct 23, 2002 JeLuF deleted "Gonville Hall, Cambridge" (Content was: \"Go\")
- 20:33 Oct 23, 2002 Maveric149 deleted "Spelling" (Put your text for the new page here. Thank you very much for your letter of support. It will be a pleasure to inform you when this project becomes available. )
- 20:33 Oct 23, 2002 JeLuF deleted "Morton's Fork" (Content was: \"test\")
- 20:32 Oct 23, 2002 JeLuF deleted "User:0" (empty page, deletion requested by Ortolan88)
- 20:29 Oct 23, 2002 Ed Poor deleted "The weather in London" (messing up the Wikipedia FAQ)
- 20:21 Oct 23, 2002 JeLuF deleted "Wikipedia:Sucks" (showing only the goats.cx-image)
- 20:20 Oct 23, 2002 Ed Poor deleted "Wikipedia:Sucks" (You didn\'t say WHY it sucks)
- 18:27 Oct 23, 2002 Maveric149 deleted "Pyramid of Djoser" (Getting this out of the way for a move back (Please read our naming conventions)
- 17:43 Oct 23, 2002 Stephen Gilbert deleted "Compound microscope" (solitation for cyber-sex)
- 17:23 Oct 23, 2002 Stephen Gilbert deleted "Tillibody" (obscure advertisement; deletion requested)
- 17:22 Oct 23, 2002 Stephen Gilbert deleted "Tagmemics" (copyright violation)
- 09:59 Oct 23, 2002 Andre Engels deleted "John Fahey" (\"This person is weird\")
- 08:10 Oct 23, 2002 Jheijmans deleted "Pet Sounds" (\"The first psychedellic album ever released.\")
- 08:10 Oct 23, 2002 Jheijmans deleted "Vince Clarke" (\"First synth player for Depeche Mode.\")
- 08:10 Oct 23, 2002 Jheijmans deleted "Charles Augustin de Coulumb" (\"hey guys!\")
- 08:09 Oct 23, 2002 Jheijmans deleted "Chuck Norris" (empty, prev \"Chuck Norris was not a Marine, he served in the US Air Force and picked up his knowledge on Martial Art while stationed in Korea\")
- 01:23 Oct 23, 2002 Brion VIBBER deleted "Beltway Sniper" (History is only cut-n-paste from Washington sniper. Need to remove to rename that article here.)
- 01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Delete" (some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)
- 01:13 Oct 23, 2002 Koyaanis Qatsi deleted "Dqwe" (some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)
- 01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete3432432" (some oddness that came about from some action of Lir\'s--intentional or not, I don\'t know)
- 01:12 Oct 23, 2002 Koyaanis Qatsi deleted "Delete123" (some oddness that came about from some action of Lir\'s--intentional or a bug, I don\'t know)
- 00:52 Oct 23, 2002 Karen Johnson deleted "Cock" (no actual info)
- 00:50 Oct 23, 2002 Karen Johnson deleted "Hillel Slovak" (the guy from the red hot chillio peppers )
- 00:49 Oct 23, 2002 Karen Johnson deleted "Surf Punks" (Local surfers into punk music & lifestyle. )
- 00:48 Oct 23, 2002 Karen Johnson deleted "Bass rap" (vandalism)
- 00:47 Oct 23, 2002 Karen Johnson deleted "Sir Andrew Ramsay" (asking for information)
- 00:45 Oct 23, 2002 Karen Johnson deleted "Sali Berisha" (foreign language microstub)
- 00:42 Oct 23, 2002 Karen Johnson deleted "Petronius" (no content)
- 00:07 Oct 23, 2002 Andre Engels deleted "Spiral galaxy" (\"Put your text for the new page here.fuuuuuuuuuuuuuuuuuuuuuuuuucccccccccccccccckkkkkkkkkkkkkkkkkkyyyyyyyyyyyyyyyyoooooooooooooooouuuuuuuuuuuuuu\" )
- 00:06 Oct 23, 2002 Andre Engels deleted "Cervidae" (\"no one likes you\")
- 00:05 Oct 23, 2002 Andre Engels deleted "Swiss Market" (\"Put your text for the new page here. market capitalization\")
- 00:03 Oct 23, 2002 Andre Engels deleted "William Rushton" (\"Put your text for the new page here. ???\")
- 19:47 Oct 22, 2002 Tarquin deleted "Lalalalalala" (stupid name.)
- 19:26 Oct 22, 2002 Andre Engels deleted "Red River (of the South)" (\"fgdfgdfgsfdsdfsfdsfdgsfdgsdfgsdfgsfdgsdfgsfdgsdfdfgffsfgsfdsfggsffgfdgsdfgsfgsfgsfgf\")
- 18:17 Oct 22, 2002 Isis deleted "Image:Janegrey.jpg" (misspelled name)
- 13:14 Oct 22, 2002 Isis deleted "Matrix(Mathematics)" (it was an error, should have had a space, the article is on the right page)
- 08:38 Oct 22, 2002 PierreAbbat deleted "Grauspitze" (non-article by 62.254.203.161: \"we want some pictures and ways to get up to the top of the peak,please help us!!!\")
- 08:07 Oct 22, 2002 Jheijmans deleted "James Richard Cross" (empty, prev \"Put your text for the new page here. he rules\")
- 08:06 Oct 22, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction" (empty, prev \"\" Famous People\")
- 08:06 Oct 22, 2002 Jheijmans deleted "2196" (empty, prev \"Alex R. arrived to receive his punishment after he was captured by jeung san do authorities in 1996 and tempoted forward in time to 2196.\")
- 08:06 Oct 22, 2002 Jheijmans deleted "Hegemon" (empty, prev \"meh\")
- 08:06 Oct 22, 2002 Jheijmans deleted "Knuths up-arrow notation" (\"Uh, what is this?\")
- 08:05 Oct 22, 2002 Jheijmans deleted "Sparks, Nevada" (\"Sparks is a city in Nevada that borders Reno.\")
- 08:04 Oct 22, 2002 Jheijmans deleted "Talk:OMW" (talk of deleted page)
- 08:03 Oct 22, 2002 Jheijmans deleted "OMW" (commercial crap in Spanish)
- 05:39 Oct 22, 2002 Maveric149 deleted "Dispatcher" (This is a window )
- 05:07 Oct 22, 2002 Maveric149 deleted "Munich" (getting this out of the way for yet another move back )
- 04:47 Oct 22, 2002 Brion VIBBER deleted "Talk:Christopher Columbus" (Need to delete to put actual talk page with its history back in place)
- 04:42 Oct 22, 2002 Brion VIBBER deleted "Christopher Columbus" (No history; need to remove to put the real article back from accidentally misspelled title)
- 03:25 Oct 22, 2002 Karen Johnson deleted "Gerdy The Dinosaur" (Lir made it, and Lir wanted it deleted)
- 00:16 Oct 22, 2002 PierreAbbat deleted "Hab Theory" (just a weblink, by 12.224.24.9)
- 00:04 Oct 22, 2002 PierreAbbat deleted "Drez" (by 200.52.162.1, just a weblink)
- 20:51 Oct 21, 2002 Tarquin deleted "Chronicle of a Death Foretold" (junk entry)
- 18:18 Oct 21, 2002 Jheijmans deleted "Talk:List of famous people who had sex with animals" (moved to meta)
- 18:18 Oct 21, 2002 Jheijmans deleted "Talk:Benjamin Netanyahu On Terrorism" (moved to meta)
- 18:17 Oct 21, 2002 Jheijmans deleted "Talk:Viral meme" (contents moved to meta)
- 18:14 Oct 21, 2002 Jheijmans deleted "39/Smooth" (copyright violation)
- 18:14 Oct 21, 2002 Jheijmans deleted "Kerplunk" (copyright violation)
- 18:14 Oct 21, 2002 Jheijmans deleted "Alice Cooper" (copyright violation)
- 18:14 Oct 21, 2002 Jheijmans deleted "PLATO game Spasim" (copyright violation)
- 18:13 Oct 21, 2002 Jheijmans deleted "Hermann Koehl" (copyright violation)
- 18:13 Oct 21, 2002 Jheijmans deleted "Hawkwind/Quark, Strangeness and Charm" (personal review)
- 18:11 Oct 21, 2002 Jheijmans deleted "Alexander Girard" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "George Nelson" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Ray Ozzie" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Herman Miller" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Gilbert Rohde" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Charles and Ray Eames" (copyright violation)
- 18:09 Oct 21, 2002 Jheijmans deleted "Isamu Noguchi" (copyright violation)
- 18:08 Oct 21, 2002 Jheijmans deleted "Gary Barwin" (copyright violation)
- 18:07 Oct 21, 2002 Jheijmans deleted "El Elote" (\"ES UN PERRON PARA EL RAP MEXICANO, UNA MEXCLA ENTRE VARIOS ESTILOS GANSTA Y HIP HOP Y ALGO DE RAGGA.\")
- 18:06 Oct 21, 2002 Jheijmans deleted "Slaughterhouse Five" (\"SLAUGHTERHOUSE-FIVE or The Children\'s Crusade (a duty-dance with death) + contents\")
- 18:06 Oct 21, 2002 Jheijmans deleted "IHTFP" (\"IHTFP means I Hate This F***ing Place. It is the popular motto of students who attend MIT\")
- 18:02 Oct 21, 2002 Jheijmans deleted "Anthony M. Buzzelli" (\"please update link to http://home.cogeco.ca/~abuzzelli/\")
- 18:02 Oct 21, 2002 Jheijmans deleted "The weather in London" (\"Actually this page does exist. (etc)\")
- 18:00 Oct 21, 2002 Jheijmans deleted "East of Eden" (\"Alyssa loves Taylor\")
- 17:02 Oct 21, 2002 Jheijmans deleted "Bergen, Netherlands" (deleting incorrect page, created by me today)
- 16:11 Oct 21, 2002 Maveric149 deleted "Munich" (getting this page out of the way for a move back)
- 13:06 Oct 21, 2002 Karen Johnson deleted "Motorola 68012" (newbie experiment)
- 12:03 Oct 21, 2002 Jheijmans deleted "Frederic Rzewski" (\"Surprisingly, an American composer.\")
- 12:02 Oct 21, 2002 Jheijmans deleted "Platonic dialogues" (\"socratic irony\")
- 12:02 Oct 21, 2002 Jheijmans deleted "Larry Brown" (empty, prev \"lalalala etc.\")
- 11:58 Oct 21, 2002 PierreAbbat deleted "KWOC" (irrelevancy by 163.117.53.82: \"el cochecito de color rojo vino por la carrtera de Boadilla\")
- 07:02 Oct 21, 2002 Maveric149 deleted "Hybrid monolithic kernel" (Put your text for the new page here.rtrete )
- 07:02 Oct 21, 2002 Maveric149 deleted "Bus mastering" (Bus mastering )
- 05:36 Oct 21, 2002 Maveric149 deleted "Tungsten/Temp" (Temp page used only for conversion)
- 04:40 Oct 21, 2002 Maveric149 deleted "Middle German" (hello )
- 04:36 Oct 21, 2002 Maveric149 deleted "Dave Farrel" (dave is a ferrell slut )
- 02:30 Oct 21, 2002 Brion VIBBER deleted "Xu language" (Non-article; no history, entire contents \"Hi my name is meri\")
- 02:22 Oct 21, 2002 Maveric149 deleted "Talk:Omagh bombing" (just a heated comment ; removed by request from the person who wrote it)
- 22:16 Oct 20, 2002 Jheijmans deleted "Hygroscopic" (\"Hygroscopic substances readily absorb water.\")
- 22:16 Oct 20, 2002 Jheijmans deleted "Andrew Hartzell" (\"- One of many Midcoast and SPNC founders.\")
- 22:15 Oct 20, 2002 Jheijmans deleted "Rodney Moore" (\"Put your text for the new page here.\")
- 22:15 Oct 20, 2002 Jheijmans deleted "Oyster" (\"See also: How to cook oysters\")
- 22:14 Oct 20, 2002 Jheijmans deleted "Turbulence" (\"Disturbance in the fluid motion.\")
- 22:14 Oct 20, 2002 Jheijmans deleted "Langjökull" (\"Langjökull, size 1.021 sq.kms.\")
- 22:14 Oct 20, 2002 Jheijmans deleted "Hofsjökull" (\"Hofsjökull, size 994 sq.kms.\")
- 22:13 Oct 20, 2002 Jheijmans deleted "Vatnajökull" (\"Vatnajökull, size 8.456 sq.kms\")
- 22:13 Oct 20, 2002 Jheijmans deleted "Absurd" (Essay moved to m:absurd)
- 22:13 Oct 20, 2002 Jheijmans deleted "Auguste Comte" (empty, prev \"Put your text for the new page here. HEy Ya\'all!!! What\'s kickin???\")
- 22:13 Oct 20, 2002 Jheijmans deleted "King Bowser Koopa" (empty, prev \"Redirect to Bowser.\")
- 22:13 Oct 20, 2002 Jheijmans deleted "Transylvanian Saxon" (empty, prev \"hello, how are you?\")
- 22:12 Oct 20, 2002 Jheijmans deleted "Mercury-in-glass thermometer" (\"GAY SHIT U R\")
- 22:12 Oct 20, 2002 Jheijmans deleted "Top-down design" (empty, \"Put your text for the new page here. ghghggg hjkhjk\")
- 22:11 Oct 20, 2002 Jheijmans deleted "Kid" (delete requested by Rlee0001)
- 22:10 Oct 20, 2002 Jheijmans deleted "Nikolay Nikolaevich Semenov" (empty, prev \"He was one bitch ass Russian.\")
- 14:35 Oct 20, 2002 Tarquin deleted "Spatial tense" (empty, no content in history)
- 13:13 Oct 20, 2002 PierreAbbat deleted "Habib Bourguiba" (junk by 193.194.75.6: \"hassal maaneh!\")
- 13:12 Oct 20, 2002 PierreAbbat deleted "Talk:Laura Welch Bush" (irrelevancy by 193.194.75.6: \"do not smok to match salem cig smok can dam your healt a tortoise.\")
- 13:10 Oct 20, 2002 PierreAbbat deleted "Adelbert von Chamisso" (nonsense by 193.194.75.6: \"chimia\")
- 13:10 Oct 20, 2002 PierreAbbat deleted "Derg" (junk by 193.194.75.6: \"la griffe d\'or\")
- 07:42 Oct 20, 2002 Maveric149 deleted "Fritz Perls" (Fritz Perl, great guy )
- 04:32 Oct 20, 2002 Maveric149 deleted "Tantalum/Temp" (Temp page used only for conversion)
- 02:32 Oct 20, 2002 The Epopt deleted "List of articles not about philosophy" (no content, no history)
- 02:30 Oct 20, 2002 The Epopt deleted "Category experiment" (no content, no history, no nothing nohow)
- 20:49 Oct 19, 2002 Jheijmans deleted "Carlow" (redirect to non-existing page)
- 20:49 Oct 19, 2002 Jheijmans deleted "José Ferrer" (redirect to non-existing page)
- 20:49 Oct 19, 2002 Jheijmans deleted "Coal/History" (redirect to non-existing page)
- 20:49 Oct 19, 2002 Jheijmans deleted "Turkmenistan/Human rights issues" (redirect to non-existing page)
- 20:48 Oct 19, 2002 Jheijmans deleted "MeaningfulNess" (redirect to non-existing page)
- 20:48 Oct 19, 2002 Jheijmans deleted "Shepherds Bush" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "Italian Communist Party" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "Fundamental dimensions/Comments" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "Monaghan" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "The Hanged Man" (redirect to non-existing page)
- 20:46 Oct 19, 2002 Jheijmans deleted "Go proverb" (redirect to non-existing page)
- 20:45 Oct 19, 2002 Jheijmans deleted "Mike Dill/My ideas on socital change and terrorism" (redirect to non-existing page)
- 20:44 Oct 19, 2002 Jheijmans deleted "Cavan" (redirect to non-existing page)
- 20:44 Oct 19, 2002 Jheijmans deleted "McMahon Act" (redirect to non-existing page)
- 20:43 Oct 19, 2002 Jheijmans deleted "Writ of Certiorari" (redirect to non-existing page)
- 20:43 Oct 19, 2002 Jheijmans deleted "Sanguozhi" (redirect to non-existing page)
- 20:42 Oct 19, 2002 Jheijmans deleted "NAGPRA" (redirect to non-existing page)
- 20:42 Oct 19, 2002 Jheijmans deleted "Ozarks" (redirect to non-existing page)
- 20:42 Oct 19, 2002 Jheijmans deleted "James Barrie" (redirect to non-existing page)
- 20:41 Oct 19, 2002 Jheijmans deleted "Fuller Seminary" (redirect to non-existing page)
- 20:41 Oct 19, 2002 Jheijmans deleted "Erichtheus" (redirect to non-existing page)
- 20:41 Oct 19, 2002 Jheijmans deleted "Human rights abuses" (redirect to non-existing page)
- 20:40 Oct 19, 2002 Jheijmans deleted "C-47 Dakota" (redirect to non-existing page)
- 20:39 Oct 19, 2002 Jheijmans deleted "C-47 Gooney Bird" (redirect to non-existing page)
- 20:11 Oct 19, 2002 Jheijmans deleted "NormanWerner" (personal page with only e-mail addresses and nonsense)
- 20:08 Oct 19, 2002 Jheijmans deleted "Propaganda/Slogans" (\"terrell ate danee out \")
- 20:07 Oct 19, 2002 Jheijmans deleted "Reel-to-Reel" (Put your text for the new page here. red apple )
- 20:01 Oct 19, 2002 Jheijmans deleted "Microdot" (empty, prev \"Alabama \")
- 20:00 Oct 19, 2002 Jheijmans deleted "CPM-86" (empty, prev \" YOU SUCK!\" (in H1-tags))
- 20:00 Oct 19, 2002 Jheijmans deleted "Talk:Millinery" (talk of removed page)
- 20:00 Oct 19, 2002 Jheijmans deleted "Millinery" (empty \"this is strange very strange so strange it is beyond human means to describe the strangeness strange strange it is strange and that is the truth\")
- 20:00 Oct 19, 2002 Jheijmans deleted "2205 BC" (empty, prev \"1000000000000000000000000000000000000000000000000000000 \")
- 19:59 Oct 19, 2002 Jheijmans deleted "Mikrophunk" (empty, prev \"los chilangos que estan sonando mas duro...... \")
- 19:59 Oct 19, 2002 Jheijmans deleted "Gundobad" (empty, prev \"Gundobada \")
- 19:59 Oct 19, 2002 Jheijmans deleted "Best-first search" (empty, prev \"Put your text for the new page here. ok \")
- 19:58 Oct 19, 2002 Jheijmans deleted "Talk:Philip III of Spain" (talk of removed page)
- 19:58 Oct 19, 2002 Jheijmans deleted "Philip III of Spain" (empty, prev \" Ate peaches for fun. I love peaches. Look at these! They are peaches. \" )
- 19:58 Oct 19, 2002 Jheijmans deleted "Ferdinand I, Holy Roman Emperor" (empty, prev \"Go to the pep rally with Ferdinand I. \")
- 19:55 Oct 19, 2002 Jheijmans deleted "Jun Fan" (empty, prev \"Put your text for the new page here. jjiilkl \" )
- 18:01 Oct 19, 2002 Maveric149 deleted "Siemens Nixdorf Informationssysteme AG" (sdfg)
- 17:38 Oct 19, 2002 Maveric149 deleted "Liaotung Peninsula" (Put your text for the new page here. liaotung peninsula is cool )
- 16:29 Oct 19, 2002 PierreAbbat deleted "Image:Test.phtml" (also only says \"<? phpinfo() ?>\")
- 16:25 Oct 19, 2002 PierreAbbat deleted "Image:Test.php" (orphan file uploaded by Testtest; only text \"<? phpinfo() ?>\")
- 16:17 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1edit.txt" (More Javascript by Jokerman)
- 16:15 Oct 19, 2002 PierreAbbat deleted "Image:PrattProfile1.txt" (HTML with Javascript uploaded by known junk uploader Jokerman9001)
- 13:35 Oct 19, 2002 Koyaanis Qatsi deleted "Image:Djmangoo-themelody.ogg" (doens\'t work, reports itself as 0 bytes)
- 13:34 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile1.gif" (image used for HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif" (image description page for image used in HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 13:33 Oct 19, 2002 Koyaanis Qatsi deleted "Image:SevenDayPrattProfile2.gif" (image used in HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1.txt" (HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 13:32 Oct 19, 2002 Koyaanis Qatsi deleted "Image:PrattProfile1edit.txt" (HTML page with improper extension, javascript, talks about hacking computers, quotes Churchill, other random junk)
- 09:52 Oct 19, 2002 Karen Johnson deleted "Bobby Bonds" (garbage)
- 09:49 Oct 19, 2002 Karen Johnson deleted "Euramerica" (gibberish)
- 09:48 Oct 19, 2002 Karen Johnson deleted "Hermeneutic" (garbage)
- 09:13 Oct 19, 2002 Karen Johnson deleted "Microsoft SQL server" (garbage)
- 08:54 Oct 19, 2002 Karen Johnson deleted "Maynard James Keenan" (garbage)
- 08:27 Oct 19, 2002 Karen Johnson deleted "Macuxi" (gibberish)
- 08:25 Oct 19, 2002 Karen Johnson deleted "Padborg" (sole contents \'german speaking town\')
- 04:48 Oct 19, 2002 Koyaanis Qatsi deleted "Two Women" (hedhdhhbd\'d dfjlidshljfkdhdf sdifldfkhljh\'ssdo;shgdffffffffffffffffffffffffffhhhhhhhhhhhhhhhhh dhljfkhlfkdh;akslhf;dsjlkhafk;jhdflkjhdflkjdhflk dhfo;jkahfk;jfdhk;lfd dfhlasdjfkhlgasdjfk )
- 04:46 Oct 19, 2002 Koyaanis Qatsi deleted "A page that will never be written unless some jerk writes it" (non-encyclopedic, should be left unwritten for wikipedia:how to start a page example)
- 01:34 Oct 19, 2002 Maveric149 deleted "Hernan Cortes" (need to get this out of the way for a move)
- 01:19 Oct 19, 2002 PierreAbbat deleted "Parse tree" (test by 151.203.58.43)
- 23:30 Oct 18, 2002 PierreAbbat deleted "Newbie" (Vandalism by 203.166.96.234, now blocked. Only text \"UP YOURS! NIGGER!\".)
- 22:19 Oct 18, 2002 Maveric149 deleted "Canadian Alliance" (Getting this out of the way for a correct move)
- 22:05 Oct 18, 2002 Maveric149 deleted "Thirteen Years' War" (Getting this out of the way for a correct move)
- 21:18 Oct 18, 2002 Ed Poor deleted "Univeristy of California, Berkeley" (misspelling, nothing links here)
- 20:46 Oct 18, 2002 Lee Daniel Crocker deleted "Max Stirner" (Preparing for move)
- 18:52 Oct 18, 2002 Maveric149 deleted "Hawker Hunter" (hawker hunter )
- 11:34 Oct 18, 2002 Karen Johnson deleted "Lindau" (garbage)
- 11:33 Oct 18, 2002 Karen Johnson deleted "Ruma" (gibberish)
- 11:32 Oct 18, 2002 Karen Johnson deleted "KDD" (gibberish)
- 11:31 Oct 18, 2002 Karen Johnson deleted "Law of conservation of matter" (garbage)
- 10:38 Oct 18, 2002 PierreAbbat deleted "Asymmetric cryptography" (garbage by 193.1.206.62: \"Put your text for the new page here. hi ya mary knkjoj\")
- 03:43 Oct 18, 2002 PierreAbbat deleted "Battle of Eylau" (nonsense by 205.188.208.40: \"hi this was a great aritiv\")
- 00:03 Oct 18, 2002 PierreAbbat deleted "My" (garbage article by 12.39.89.31)
- 23:03 Oct 17, 2002 Andre Engels deleted "Chilomonas" (Full text: \"Stuff happens! Hey there Fhqwhgads! Hey there Fh-qw-h-gads! Everybody to the limit!\")
- 22:30 Oct 17, 2002 PierreAbbat deleted "2208" (nonsense prediction by 209.107.95.230)
- 22:28 Oct 17, 2002 PierreAbbat deleted "Water wheel" (newbie calling attention to a typo in Pelton; fixed)
- 22:25 Oct 17, 2002 PierreAbbat deleted "ASF" (question from 141.155.124.102: \"What is an ASF file?\" Beats me; someone sent me one and I have no idea what to read it with.)
- 18:23 Oct 17, 2002 Maveric149 deleted "Goedel's completeness theorem" (need to get this out of the way for a more -- nothing but a redirect, no content in history)
- 13:51 Oct 17, 2002 Andre Engels deleted "Soon" (nonsense; moved to \"Bad Jokes etc.\")
- 12:34 Oct 17, 2002 Andre Engels deleted "First Crusade" (redirect without history; making place for a move)
- 12:00 Oct 17, 2002 Stephen Gilbert deleted "Wardian case" (created by a bug, it seems)
- 01:51 Oct 17, 2002 PierreAbbat deleted "Christian Dior" (nonsense by 203.108.4.66: \"Put your text for the new page here. ytytyrt\")
- 01:49 Oct 17, 2002 PierreAbbat deleted "Hybrid monolithic kernel" (garbage by 64.48.234.45: \"Put your text for the new page here. tonima ,,h\")
- 01:15 Oct 17, 2002 Stephen Gilbert deleted "Turn-based game" (\"put the text for the new page here\" plus a newbie test)
- 01:15 Oct 17, 2002 Stephen Gilbert deleted "Alain Mimoun" (\"Put the text for the new page here\" plus a newbie test)
- 22:09 Oct 16, 2002 PierreAbbat deleted "Screen Actors Guild" (newbie experiment by 205.188.209.171: only text \"weeeeeeeee\")
- 22:08 Oct 16, 2002 PierreAbbat deleted "Middle-Earth Roleplaying System" (newbie experiment by 12.19.140.49: only text \"what the heck?\")
- 19:46 Oct 16, 2002 Tarquin deleted "Conspicuous consumption" (junk entry. see my suggestion on the mailing list!)
- 15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology" (redirect without history; making place for a move)
- 15:53 Oct 16, 2002 Andre Engels deleted "Talk:Scientific mythology" (redirect without history; making place for a move)
- 15:52 Oct 16, 2002 Andre Engels deleted "Scientific mythology" (redirect without history; making place for a move)
- 15:48 Oct 16, 2002 Tarquin deleted "Blue Nile" (junk entry)
- 15:33 Oct 16, 2002 Andre Engels deleted "Talk:Hayden Christiansen" (\"His name is Christensen, not Christiansen\" - page has now been moved)
- 15:27 Oct 16, 2002 Andre Engels deleted "Talk:Millions of worthless articles" (talk page to deleted page)
- 15:22 Oct 16, 2002 Andre Engels deleted "Talk:Friends United Meeting" (talk page to deleted page)
- 15:10 Oct 16, 2002 Andre Engels deleted "Talk:Q Codes" (\"his page can be deleted now that I have changed the referring links to point to Q Code.\" - subject page is a redirect to Q Code, which means this talk has been dealt with adequately)
- 11:53 Oct 16, 2002 PierreAbbat deleted "Thivai" (junk by 202.67.64.154: \"thivai is cool!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!\")
- 11:40 Oct 16, 2002 PierreAbbat deleted "Travels With Charley" (garbage by 152.163.189.170: long string of \'n\' and \'o\')
- 11:38 Oct 16, 2002 PierreAbbat deleted "Problem domain" (newbie experiment by 144.16.64.4: only text \"public range\")
- 11:22 Oct 16, 2002 Andre Engels deleted "John Forbes Nash" (redirect without history; making place for a move)
- 10:43 Oct 16, 2002 Jheijmans deleted "The Oresteia" (\"Classic depiction of the battle with Persia featuring Cassandra.\")
- 10:43 Oct 16, 2002 Jheijmans deleted "Business management" (\"The activity of managing a commercial enterprise or business.\")
- 10:42 Oct 16, 2002 Jheijmans deleted "Ray Gillen" (\"Recorded Eternal Idol, which was rerecorded with Tony Martin.\")
- 09:35 Oct 16, 2002 Andre Engels deleted "Image:German flag 1815.png" (Duplicate of Germany_flag_1815.png ; deletion requested by uploader)
- 09:33 Oct 16, 2002 Andre Engels deleted "Xenon/Temp" (Temp page; contents have already been moved to the main article)
- 08:09 Oct 16, 2002 Sjc deleted "Amatol" (Random garbage)
- 06:47 Oct 16, 2002 Jheijmans deleted "Akron, Ohio" (\"This is a specially made toilet located in ohio\")
- 06:47 Oct 16, 2002 Jheijmans deleted "Penal code" (\"Put your text for the new page here. ca\")
- 06:47 Oct 16, 2002 Jheijmans deleted "Superstring" (\"super strings!!!\")
- 06:47 Oct 16, 2002 Jheijmans deleted "Unified field theory" (empty, prev \"asdf\")
- 06:46 Oct 16, 2002 Jheijmans deleted "Other LZ compression methods" (\"u can u see u hepl\")
- 06:46 Oct 16, 2002 Jheijmans deleted "Bizarro" (empty, prev \"Put your text for the new page here. hjkhjkhj\")
- 06:46 Oct 16, 2002 Jheijmans deleted "Ear piercing" (empty, prev \"Put your text for the new page here. trtrtrtrtrtrtr\")
- 05:59 Oct 16, 2002 Sjc deleted "Flying Wedge" (Another joke: this is about ATMs and has nothing to do with the famous All Black Flying Wedge)
- 05:57 Oct 16, 2002 Sjc deleted "AEW" (A joke page: not even remotely worthy of redemption)
- 02:47 Oct 16, 2002 PierreAbbat deleted "Homeric Hymns" (garbage by 66.69.208.90: \"what did he want\")
- 02:46 Oct 16, 2002 PierreAbbat deleted "Pisistratos" (garbage by 66.69.208.90: \"Haha if your reading this you suck :P\")
- 01:19 Oct 16, 2002 Maveric149 deleted "Sweet Home Alabama (movie)" (t was good!!!!!!!!!!!!!!!!!!!! )
- 01:05 Oct 16, 2002 Maveric149 deleted "USS Valley" (redirect to non-existant page)
- 00:14 Oct 16, 2002 PierreAbbat deleted "Jay Warren" (nonsense by 212.253.158.230: \"Put your text for the new page here.www.expage.com/thaumaturgy\")
- 00:12 Oct 16, 2002 PierreAbbat deleted "Mustique" (non-article by 194.238.50.52: \"Mustique is the most amasing pkace i have evr been to it\'s so fantastic it\'s unreal.\")
- 22:56 Oct 15, 2002 Maveric149 deleted "Egg cell" (Put your text for the new page here. )
- 22:53 Oct 15, 2002 Jheijmans deleted "Ciutat Vella" (empty, prev \"Barri del casc antic de barcelona.\")
- 22:49 Oct 15, 2002 Jheijmans deleted "Like nailing jelly to a tree" (orphan from jargon file \"Like nailing jelly to a tree\")
- 22:48 Oct 15, 2002 Jheijmans deleted "Like kicking dead whales down the beach" (orphan from jargon file \"Like kicking dead whales down the beach is a phrase used to describe a slow, difficult, and disgusting process. It was first popularized by a famous quote about the difficulty of getting work done under one of IBM\'s mainframe operating systems. \"Well, you could write a C compiler in COBOL, but it would be like kicking dead whales down the beach.\" See also fear and loathing.\")
- 22:16 Oct 15, 2002 Jheijmans deleted "James Batcheller Sumner" (empty, prev \"ok\")
- 22:16 Oct 15, 2002 Jheijmans deleted "MC Det" (\"you silly cunt dont try to test me ill av u shoot get some new style\")
- 22:06 Oct 15, 2002 Jheijmans deleted "New England boiled dinner" (empty, prev \"fag\")
- 22:06 Oct 15, 2002 Jheijmans deleted "1208 BC" (empty, prev \"Put your text for the new page here. hey babe\")
- 22:06 Oct 15, 2002 Jheijmans deleted "WikiProject Biology" (\"bitch\")
- 22:05 Oct 15, 2002 Jheijmans deleted "Abelian variety" (\"Dude!\")
- 22:05 Oct 15, 2002 Jheijmans deleted "Cassette" (\"STORAGE DEVICES\")
- 22:04 Oct 15, 2002 Jheijmans deleted "DBA" (\"Database Administrator\")
- 22:04 Oct 15, 2002 Jheijmans deleted "Application layer" (\"what is this all about\")
- 22:04 Oct 15, 2002 Jheijmans deleted "Vacation" (\"Time off work. A holiday.\")
- 22:04 Oct 15, 2002 Jheijmans deleted "Caledonia" (\"(Latin name for:) Scotland\")
- 22:03 Oct 15, 2002 Jheijmans deleted "Lamp" (\"Lamp. Typically a deskside light source\")
- 22:03 Oct 15, 2002 Jheijmans deleted "Talk:Status" (talk of deleted page)
- 22:03 Oct 15, 2002 Jheijmans deleted "Status" (wikipedia is not a dictionary)
- 22:02 Oct 15, 2002 Jheijmans deleted "Mathematics Magazine" (\"pok\")
- 22:02 Oct 15, 2002 Jheijmans deleted "Rangefinder cameras" (\"hi my name is bob. :)\")
- 22:02 Oct 15, 2002 Jheijmans deleted "Copy protection" (empty, prev \"Put your text for the new page here. go next\")
- 22:02 Oct 15, 2002 Jheijmans deleted "Other LZ compression methods" (empty creation)
- 22:01 Oct 15, 2002 Maveric149 deleted "Laccolith" (\"fuck u alll i hate scince \" Apparently you didn\'t care for English class either)
- 19:37 Oct 15, 2002 Brion VIBBER deleted "Microsoft Windows 2.0" (Non-article; only content \"Where i can download Windows 1.0 and windows 2.0 please send me link tapster@wp.pl thx\")
- 18:59 Oct 15, 2002 Stephen Gilbert deleted "Talk:Put" (article page deleted; no useful content)
- 18:58 Oct 15, 2002 Stephen Gilbert deleted "SPIHT" (newbie experiment; deletion requested)
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "Put" (copyright violation; requested deletion)
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "Marcel Petiot" (copyright violation; requested deletion)
- 18:57 Oct 15, 2002 Stephen Gilbert deleted "WSDL" (copyright violation; requested deletion)
- 18:28 Oct 15, 2002 Magnus Manske deleted "Ländervorwahlen/nachNummern" (Says \"0041 Switzerland 0049 Germany\")
- 18:26 Oct 15, 2002 Tarquin deleted "User:ZxAnPhOrIaN/StateReportSites" (by request of user)
- 18:00 Oct 15, 2002 Scipius deleted "Jean Renoir" (Full text: \"bum\")
- 14:48 Oct 15, 2002 Tarquin deleted "Cretinous" (more jargon file stuff. not a fictionary, etc)
- 14:44 Oct 15, 2002 Tarquin deleted "Brain-damaged" (please could we stop importing dross from the jargon file?)
- 13:10 Oct 15, 2002 Tarquin deleted "Calculus/chain rule" (fixed links to this page. The full article is at Chain rule)
- 12:29 Oct 15, 2002 Tarquin deleted "Prime number/Talk" (just junk)
- 10:16 Oct 15, 2002 Jheijmans deleted "Slovenia/Temp" (temporary page)
- 06:42 Oct 15, 2002 Jheijmans deleted "USS Lake" (\"The correct name of this ship is USS Lake Champlain.\")
- 06:41 Oct 15, 2002 Jheijmans deleted "USS Philippine" (\"The correct name of this ship is USS Philippine Sea.\")
- 06:41 Oct 15, 2002 Jheijmans deleted "USS Bunker" (\"The correct name of this ship is USS Bunker Hill.\")
- 06:40 Oct 15, 2002 Jheijmans deleted "USS San" (\"The correct name of this ship is USS San Jacinto.\")
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Leyte" (\"The correct name of this ship is USS Leyte Gulf.\")
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Coral" (\"The correct name of this ship is USS Coral Sea\")
- 06:40 Oct 15, 2002 Jheijmans deleted "USS Belleau" (\"Correct name of this ship is USS Belleau Wood\")
- 06:09 Oct 15, 2002 Karen Johnson deleted "USS Franklin" (blank)
- 02:02 Oct 15, 2002 Karen Johnson deleted "Brown Deer, Wisconsin" (garbage)
- 02:01 Oct 15, 2002 Karen Johnson deleted "4004 BC" (irrelevant url)
- 02:01 Oct 15, 2002 Karen Johnson deleted "Jacques Cossette-Trudel" (swearing in french)
- 02:00 Oct 15, 2002 Karen Johnson deleted "University of Wisconsin, Stout" (irrelevancy)
- 01:59 Oct 15, 2002 Karen Johnson deleted "Jangyn Bridge" (\'hi\')
- 01:59 Oct 15, 2002 Karen Johnson deleted "Poissy" (blank)
- 01:59 Oct 15, 2002 Karen Johnson deleted "Talk:Poissy" (irrelevant & article is being deleted (1 sentence only))
- 01:58 Oct 15, 2002 Karen Johnson deleted "Xerox 1108" (experiment)
- 01:57 Oct 15, 2002 Karen Johnson deleted "Data vector" (totally irrelevant paragraph)
- 01:55 Oct 15, 2002 Karen Johnson deleted "Danville, Kentucky" (obscenity)
- 22:15 Oct 14, 2002 Jheijmans deleted "Bosnian language" (empty, previously \"thank you \")
- 21:57 Oct 14, 2002 Scipius deleted "Electric battery" (Full text: \"I like turtles. They are round. \" Indeed.)
- 21:44 Oct 14, 2002 Scipius deleted "Talk:Germany/Temp" (/Temp page no longer necessary)
- 21:43 Oct 14, 2002 Scipius deleted "Germany/Temp" (/Temp page no longer necessary)
- 21:13 Oct 14, 2002 Jheijmans deleted "Erasmus" (needed for move, no history but \"conversion script\")
- 21:00 Oct 14, 2002 PierreAbbat deleted "General Federation of Jewish Labour" (newbie experiment by 12.236.210.167: only content \"Oh\")
- 16:35 Oct 14, 2002 Jheijmans deleted "Liudolf of Swabia" (only genealogical information (\"Eldest son of Otto I the Great and his first wife, Eadgyth.\"), orphan (only linked from talk page))
- 16:33 Oct 14, 2002 Jheijmans deleted "Quay" (Wikipedia is not a dictionary)
- 16:30 Oct 14, 2002 Jheijmans deleted "Emma Bunton" (empty, previous two types of vandalism, last \"jander jander jander\")
- 16:30 Oct 14, 2002 Jheijmans deleted "Pavel Chekov" (empty, prev \"He is shite\")
- 12:26 Oct 14, 2002 Brion VIBBER deleted "TWA 847 hijacking" (Only content \"cool terrorist actions. 88\"; no history; by known vandal 24.201.235.57)
- 11:58 Oct 14, 2002 PierreAbbat deleted "U.S. presidential election, 2012" (too far in the future to say anything)
- 09:31 Oct 14, 2002 Maveric149 deleted "Route inspection problem" (Put your text for the new page here. gdgdfgdfgdfgdfgd )
- 08:55 Oct 14, 2002 Maveric149 deleted "Popper" (junk; moved to bad jokes)
- 07:56 Oct 14, 2002 Magnus Manske deleted "Henk Rogers" (Says \"A person.\")
- 07:49 Oct 14, 2002 Jheijmans deleted "Ani Yuntikwalaski" (copyright violation, been on votes for deletion for a while)
- 07:48 Oct 14, 2002 Jheijmans deleted "Zulch, Evan" (redirect to deleted page)
- 07:48 Oct 14, 2002 Jheijmans deleted "Evan Zulch" (empty page)
- 07:46 Oct 14, 2002 Jheijmans deleted "Sandra Dempsey" (\"Put your text for the new page here.\")
- 07:45 Oct 14, 2002 Jheijmans deleted "Cassiodorus" (\"Put your text for the new page here. id questions for the history class\")
- 07:45 Oct 14, 2002 Jheijmans deleted "Daniel Vettori" (\"Put your text for the new page here. yes yes yes\")
- 07:44 Oct 14, 2002 Jheijmans deleted "El Lissitzky" (\"he was a great man\")
- 07:44 Oct 14, 2002 Jheijmans deleted "Text to speech" (\"New Text\")
- 07:44 Oct 14, 2002 Jheijmans deleted "Natural language generation" (\"New Text\")
- 07:44 Oct 14, 2002 Jheijmans deleted "Program transformation" (\"Test?\")
- 06:27 Oct 14, 2002 Sjc deleted "Maclyn McCarty" (Non-page: contained only the statement: \"A nice guy^_^\")
- 04:24 Oct 14, 2002 Maveric149 deleted "2109" (Hi every body )
- 03:37 Oct 14, 2002 Maveric149 deleted "Phosphorus/Temp" (temp page that is no longer needed)
- 01:03 Oct 14, 2002 Maveric149 deleted "Law of Octaves" (kjhjhjh )
- 00:56 Oct 14, 2002 Maveric149 deleted "André Malraux" (need to get this out of the way for a correct move)
- 22:53 Oct 13, 2002 PierreAbbat deleted "Rockefeller Institute" (useless entry by 63.199.203.105: \"A very good school.\")
- 22:52 Oct 13, 2002 PierreAbbat deleted "Acrostic puzzle" (Newbie experiment by 65.29.135.209. uepnco)
- 22:50 Oct 13, 2002 Tarquin deleted "Raymon Smullyan" (typo)
- 21:19 Oct 13, 2002 Bryan Derksen deleted "Great Red Spot" (Making room for a move. This is a redirect with no history.)
- 21:14 Oct 13, 2002 Maveric149 deleted "Superscript" (Wikipedia is not a dictionary)
- 21:13 Oct 13, 2002 Maveric149 deleted "Natural order" (Wikipedia is not a dictionary)
- 21:08 Oct 13, 2002 Andre Engels deleted "Talk:Confused Deputy Problem" (talk page to deleted page)
- 21:01 Oct 13, 2002 Andre Engels deleted "Talk:Common Earth Language" (talk page to deleted page)
- 20:58 Oct 13, 2002 Andre Engels deleted "Xerox Document Company" (\"Put your text for the new page here. hgia\")
- 20:58 Oct 13, 2002 Andre Engels deleted "Nuclear pile" (\"whatevefr\")
- 17:31 Oct 13, 2002 PierreAbbat deleted "Cheddite" (nonsense by 212.7.9.35; only text \"Put your text for the new page here.ch2)3n2*hclo4)2 8 km/sec.\")
- 12:25 Oct 13, 2002 PierreAbbat deleted "Supercharger" (nonsense by 62.253.96.5; only contents \"Willy willy willy\")
- 10:32 Oct 13, 2002 Sjc deleted "Holt, England" (There are a number of Holts in England in different counties)
- 10:24 Oct 13, 2002 Jheijmans deleted "Loaded terminology" (dictionary definition)
- 09:49 Oct 13, 2002 Scipius deleted "Quercus robur- Ongoing projects & To Do list..." (Deletion of a user\'s to do list that has been moved into user space)
- 07:46 Oct 13, 2002 Sjc deleted "October 12 2002 car bomb, Kuta, Bali" (Date of event incorrect: new page similarly entitled at 11/10/2002)
- 07:04 Oct 13, 2002 Maveric149 deleted "Latin phrases" (need to get this out of the way for a correct move)
- 02:14 Oct 13, 2002 Maveric149 deleted "American Christian Zionists" (Referring to a politically Zionist agenda of American Christian Fundamentalists. ; Wikipedia is not a dictionary and this term appears to be ideosyncratic)
- 23:34 Oct 12, 2002 Scipius deleted "Curly Howard" (Full text: \"nyuk \")
- 22:20 Oct 12, 2002 Jheijmans deleted "Steamboat" (\"poop\")
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page A" (REDIRECT Redirect test page B)
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page C" (REDIRECT Redirect test page A)
- 21:41 Oct 12, 2002 Magnus Manske deleted "Redirect test page B" (REDIRECT Redirect test page C)
- 21:12 Oct 12, 2002 Tarquin deleted "Talk:The simpsons/dr. nick riviera" (wrong page title -- doesnt match the real article and empty)
- 20:37 Oct 12, 2002 Jheijmans deleted "Kent Keith" (\"http://www.paradoxicalcommandments.com/\")
- 20:35 Oct 12, 2002 Jheijmans deleted "FrameMaker" (empty, prev \"ut your text for the new page here. This paper seeks to assess the effectiveness of a popular grammar and style checker, Grammatik V, (etc.)\")
- 16:35 Oct 12, 2002 Andre Engels deleted "Robert Guiscard" (copyright violation; from votes for deletion)
- 15:59 Oct 12, 2002 Andre Engels deleted "SoHo, New York City, New York" (recently created orphan; deletion requested by originator)
- 15:59 Oct 12, 2002 Andre Engels deleted "Murray Hill, New York City, New York" (recently created orphan; deletion requested by originator)
- 15:58 Oct 12, 2002 Andre Engels deleted "Harlem, New York City, New York" (orphan; deletion requested by originator)
- 15:58 Oct 12, 2002 Andre Engels deleted "Greenwich Village, New York City, New York" (orphan; deletion requested by originator)
- 15:32 Oct 12, 2002 PierreAbbat deleted "List of famous people who had sex with animals" (Page by 213.122.219.144, previously deleted.)
- 14:36 Oct 12, 2002 Tarquin deleted "ZxAnPhOrIaN/StateReportSites" (moved to user space)
- 13:09 Oct 12, 2002 PierreAbbat deleted "Charles Cunningham Boycott" (garbage by 64.105.22.115: \"he was boned in 1832, and choked to death on a sandwhich in 1897.... O NO WAIT\" etc.)
- 12:10 Oct 12, 2002 Andre Engels deleted "Internet gaming" (useless stub: \"Games played on or with the aid of internet communications.\")
- 12:09 Oct 12, 2002 Andre Engels deleted "Joe Rock" (\"hey so you like... stuff\")
- 12:08 Oct 12, 2002 Andre Engels deleted "Herman Brusselmans" (empty page, previously \"Ne Klootzak die alleen maar vuilspuiterij kan schrijven over beffen en kakken\" (which is some Dutch insult to the person the page should be about))
- 12:08 Oct 12, 2002 Andre Engels deleted "Queen Anne's War" (empty page, previous text \"HEY WHATS UP EVERYONE, IF U WANT INFO, U WONT FIND ITHERE HAHAHAH\")
- 11:49 Oct 12, 2002 Karen Johnson deleted "Europrix" (garbage)
- 03:36 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (city names)" (need to get this out of the way for a move-back)
- 03:35 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (ships)" (need to get this out of the way for a move-back)
- 03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (movies)" (need to get this out of the way for a move-back)
- 03:34 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (names and titles)" (need to get this out of the way for a move-back)
- 03:33 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (precision)" (need to get this out of the way for a move-back)
- 03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (common names)" (need to get this out of the way for a move-back)
- 03:32 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (anglicization)" (need to get this out of the way for a move-back)
- 03:31 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (pluralization)" (need to get this out of the way for a move-back)
- 03:30 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (capitalization)" (need to get this out of the way for a move-back)
- 03:28 Oct 12, 2002 Maveric149 deleted "Wikipedia:Naming conventions (acronyms)" (need to get this out of the way for a move-back)
- 02:25 Oct 12, 2002 Karen Johnson deleted "VMWare" (vandalism)
- 02:24 Oct 12, 2002 Karen Johnson deleted "List of famous people who had sex with animals" (i seriously doubt we need this page! )
- 00:27 Oct 12, 2002 Tarquin deleted "HfTupper" (mysterious empty orphan with no history)
- 23:47 Oct 11, 2002 Andre Engels deleted "List of collective nouns by collective terms" (mis-move, moved on to Talk:List_of_collective_nouns_by_collective_term)
- 23:44 Oct 11, 2002 Andre Engels deleted "Talk:ColdWar" (empty; old contents only the (unanswered) question how pages are moved)
- 23:03 Oct 11, 2002 Andre Engels deleted "Talk:Chinese characteristics" (\"Put your text for the new page here. Gentle Bear\")
- 22:58 Oct 11, 2002 Andre Engels deleted "Talk:Queen (Chess)" (mis-move, page should have gone to Talk:Queen (chess) (and is there now))
- 22:49 Oct 11, 2002 Andre Engels deleted "Talk:Ǭç¹è§è§£" (talk page of deleted page)
- 22:38 Oct 11, 2002 Andre Engels deleted "Talk:Candy blunt" (talk to deleted page)
- 22:33 Oct 11, 2002 Andre Engels deleted "Talk:Business and Industry basic topics" (empty page, only history \"Describe the new page here\")
- 22:28 Oct 11, 2002 Andre Engels deleted "Talk:Bubi" (talk page of deleted page)
- 22:26 Oct 11, 2002 Scipius deleted "Mossel Bay" (Full text: \"Put your text for the new page here.about the of bartolamev dias \")
- 22:25 Oct 11, 2002 Scipius deleted "Georges Pompidou" (Full text: \"ÒÓÓÓÓÓÓÓÓÓÓ!!!!!!!!!!11 ÏÐÈÂÅÒÈÊÈ ÈÇ ÁÅËÀÐÓÑÈ!!!!!!!!!!!! BELARUS!!!!!!!!!!!!!!!!!!!!1 \")
- 22:24 Oct 11, 2002 Scipius deleted "Carboxyl group" (Full text: \"carboxyl\")
- 22:20 Oct 11, 2002 Andre Engels deleted "Talk:Bridge game" (only text \"see Talk:Contract bridge for a suggestion on moving this page -- Tarquin\" - outdated, since the move has already taken place)
- 22:17 Oct 11, 2002 Andre Engels deleted "Talk:Boure" (talk page to deleted page)
- 22:16 Oct 11, 2002 Andre Engels deleted "Talk:Boris the crazy Russian" (talk page to deleted page)
- 22:08 Oct 11, 2002 Andre Engels deleted "Talk:Blue-green money" (talk of deleted page)
- 22:00 Oct 11, 2002 Andre Engels deleted "Talk:Bilbo" (\"Why doesn\'t the redirect work? And shouldn\'t the article be entitled Bilbo rather than using the slash?\" - the redirect works, and there is no slash to be found anywhere)
- 21:49 Oct 11, 2002 Andre Engels deleted "Talk:Belief in God spectrum" (talk page without subject page; contents are already on meta)
- 21:41 Oct 11, 2002 Andre Engels deleted "Talk:Battle of TannenburgBattle of Grunwald" (talk of deleted page, only saying where it should be redirected)
- 21:34 Oct 11, 2002 Andre Engels deleted "Talk:Baptism of the dead" (talk page to deleted page)
- 21:33 Oct 11, 2002 Andre Engels deleted "Talk:Bantu languages" (only text \"The text from Bantu should be moved here\" (which happened ages ago); making place for a move of Talk:Bantu)
- 21:30 Oct 11, 2002 Andre Engels deleted "Talk:Baker Natalie Bachrach" (talk page without subject page)
- 18:29 Oct 11, 2002 Ed Poor deleted "Talk:List of famous people who have pierced their private parts" (Requested by Easter Bradford)
- 17:50 Oct 11, 2002 Jheijmans deleted "Victoria, Seychelles" (\"yyyyyyyyyyyyyyyyyyyyyy\")
- 11:54 Oct 11, 2002 Andre Engels deleted "Nika revolt" (copyright violation; on votes for deletion for over a week)
- 11:50 Oct 11, 2002 PierreAbbat deleted "Togidubnus" (212.23.26.209 claims to have been Togidubnus in a past life)
- 11:15 Oct 11, 2002 Karen Johnson deleted "Antonella Brugnola" (unneeded double redirect)
- 07:21 Oct 11, 2002 Jheijmans deleted "Siobhan Fahey" (\"The offical siobhan fahey website can be found at: http://www.siobhanfahey.com/\")
- 07:21 Oct 11, 2002 Jheijmans deleted "Augusta of Saxe-Gotha" (\"hey y\'all, i\'m from texas, can\'t y\'all tell? good luck with your research on Augusta of Saxe-Gotha. Now, did y\'all really expect 2 find some information on this old lady from an old texan? now i didn\'t think so!bye, luv y\'all!\")
- 07:20 Oct 11, 2002 Jheijmans deleted "Governor-General's Award for Creative Non-Fiction" (\"famous people the mccaughan\'s family Brad McCaughan Carolyn McCaughan Samantha McCaughan Gregory McCaughan Timothy McCaughan Tappy McCaughan\")
- 07:19 Oct 11, 2002 Jheijmans deleted "War of the Grand Alliance" (\"considering the fact that spain sucks, i will not write anything about this subject! GO...\")
- 07:19 Oct 11, 2002 Jheijmans deleted "William Pitt, the Younger" (\"Hi people, its bill bob joe! i luv u all!! hugs and kisses!! hope u like my page bout william pitt, the younger! hope it helps with your report!!! luv ya all\")
- 06:50 Oct 11, 2002 Jheijmans deleted "Partido dos Trabalhadores" (\"PT is a left Brazilian party.\")
- 06:49 Oct 11, 2002 Jheijmans deleted "Amazonia" (\"Amazonia Florest is Brazilian!!!!!!!\")
- 06:49 Oct 11, 2002 Jheijmans deleted "Fred Olsen" (\"http://www.fredolsen.es/lineas/english/index.htm\")
- 06:48 Oct 11, 2002 Jheijmans deleted "Talk:Autodynamics" (talk page of removed page)
- 06:48 Oct 11, 2002 Jheijmans deleted "Autodynamics" (former nonsense/poss. copyright violation)
- 06:47 Oct 11, 2002 Jheijmans deleted "DNA computer" (emptied by original author)
- 06:46 Oct 11, 2002 Jheijmans deleted "Matthew Lancelot Ryan" (emptied by Zoe)
- 05:34 Oct 11, 2002 Maveric149 deleted "Eternity" (joke; Eternity Definition: It is the moment between you come and the moment you can go home! )
- 01:49 Oct 11, 2002 PierreAbbat deleted "Toba" (khdjlkfhaslkf: Toba pagandi.)
- 01:44 Oct 11, 2002 PierreAbbat deleted "Blah" (newbie playing in sandbox)
- 01:00 Oct 11, 2002 Maveric149 deleted "Macintosh raincoat" (blank; junk in history)
- 20:49 Oct 10, 2002 Scipius deleted "Cafe wall illusion" (Full text: \"CLUB LIQUID\")
- 20:15 Oct 10, 2002 Tarquin deleted "Line segment" (just junk)
- 20:15 Oct 10, 2002 Tarquin deleted "Pembrokeshire" (just junk)
- 20:15 Oct 10, 2002 Tarquin deleted "Channel coding" (just junk)
- 18:07 Oct 10, 2002 Scipius deleted "Image:Uk flag largeupsidedown.png" (Flag no longer necessary)
- 18:04 Oct 10, 2002 Scipius deleted "Image:Waveflag.gif" (Again removed superfluous US flag)
- 16:11 Oct 10, 2002 Scipius deleted "Nixon" (Full text: \"Put your text for the new page here. crook\" (not redirected because the movie might use it))
- 12:19 Oct 10, 2002 Jheijmans deleted "Shooting at the 1936 Summer Olympics" (\"hi i amin the 9th grade doin homework for heritage 9\")
- 12:08 Oct 10, 2002 Karen Johnson deleted "Shar" (nonentry)
- 09:28 Oct 10, 2002 Jheijmans deleted "Palette" (\"Put your text for the new page here.SADSDSSSS\")
- 09:27 Oct 10, 2002 Jheijmans deleted "Executive department" (\"Put your text for the new page here.\")
- 07:00 Oct 10, 2002 Maveric149 deleted "Helium/Temp" (temp page that is no longer needed)
- 06:50 Oct 10, 2002 Robert Merkel deleted "Drexel Shaft" (joke page (content added to bad jokes and deleted nonsense))
- 06:49 Oct 10, 2002 Robert Merkel deleted "Talk:Drexel Shaft" (deleting parent page)
- 06:46 Oct 10, 2002 Jheijmans deleted "Robert Moses" (\"Put your text for the new page here.\")
- 06:46 Oct 10, 2002 Jheijmans deleted "Correspondence course" (\"master in business and administration\")
- 06:44 Oct 10, 2002 Jheijmans deleted "Discordance Axis" (\"these guys fucking rock\")
- 06:44 Oct 10, 2002 Jheijmans deleted "Frederick, Lord North" (\"Lord North was a freak!\")
- 06:44 Oct 10, 2002 Jheijmans deleted "Social Development" (\"This is whack! \")
- 06:43 Oct 10, 2002 Jheijmans deleted "Obfuscated PostScript Contest" (empty, prev \"blarg\")
- 06:43 Oct 10, 2002 Jheijmans deleted "Gungan" (empty, prev \"hello my friend my name is Jesse i am talking in wikipedia\")
- 01:19 Oct 10, 2002 PierreAbbat deleted "Pinworm" (newbie experiment by 63.226.31.222: only contents \"gay!!\")
- 00:26 Oct 10, 2002 Andre Engels deleted "Zacharias Janssen" (empty page; only former contents: \"dude\")
- 21:43 Oct 9, 2002 PierreAbbat deleted "Motnitroat" (Orphan article by 217.35.86.218 about a non-word.)
- 20:47 Oct 9, 2002 PierreAbbat deleted "Contract bridge palying technique" (orphan typo; contents have been moved to correct spelling)
- 19:54 Oct 9, 2002 Andre Engels deleted "Talk:50 kroner note" (similar to the 200 kroner note)
- 19:54 Oct 9, 2002 Andre Engels deleted "Talk:200 kroner note" (empty, and has been such for 2 1/2 months after only 13 minutes of existence with text)
- 19:48 Oct 9, 2002 Magnus Manske deleted "Topory" (Says \"Piotr Parda; Przenies sie do User: namespace, bo beda sobie robic z ciebie jaja, ze chcesz pisac artykul/ o sobie. ;-)\")
- 19:42 Oct 9, 2002 Andre Engels deleted "Talk:ATI" (talk of deleted page; only contents is the origin of the (copyright violating) information)
- 19:28 Oct 9, 2002 Ed Poor deleted "Time base" (graffiti page)
- 19:27 Oct 9, 2002 Ed Poor deleted "Staff system" (graffiti page)
- 19:27 Oct 9, 2002 Andre Engels deleted "Talk:Anthocyanins" (Only the contents of the deleted subject page, which was basically an advertisement)
- 19:26 Oct 9, 2002 Andre Engels deleted "Talk:Anomy" (empty talk page; only history \"This needs to be elaborated on\")
- 19:25 Oct 9, 2002 Andre Engels deleted "Talk:Angel/far-fetched belief" (talk of deleted page)
- 19:24 Oct 9, 2002 Andre Engels deleted "Talk:Ancient civilization" (talk about whether \'Celts\' and \'Israel\' are civilizations. Since the article is now redirecting to \'ancient history\', which does not use the term \'civilization\' at all, not of any interest)
- 19:22 Oct 9, 2002 Andre Engels deleted "Talk:Anarchy Online" (talk of deleted page, just arguing why the page should be deleted)
- 19:20 Oct 9, 2002 Andre Engels deleted "Talk:American Union of Men" (talk to deleted page)
- 19:18 Oct 9, 2002 Andre Engels deleted "Talk:Amead" (Talk to deleted page)
- 19:15 Oct 9, 2002 Andre Engels deleted "Talk:A.L.I.C.E" (Empty, has been for a long time)
- 18:57 Oct 9, 2002 Andre Engels deleted "Talk:Adek336" (talk page without subject page)
- 18:50 Oct 9, 2002 Andre Engels deleted "Talk:2002 State of the Union Address" (Talk of a page that is de facto deleted)
- 18:49 Oct 9, 2002 Andre Engels deleted "Talk:72 virgins" (talk page to deleted page)
- 18:43 Oct 9, 2002 Andre Engels deleted "Talk:23nd century" (Talk page without corresponding subject page)
- 18:39 Oct 9, 2002 Andre Engels deleted "Talk:Antiwikipedic" (moved to meta; subject page has already been deleted)
- 18:33 Oct 9, 2002 Andre Engels deleted "Painting techniques" (Just the beginning of \'Impressionism\' copied (even with the \'redirected from Impressionist\' in it))
- 18:32 Oct 9, 2002 Andre Engels deleted "Anna Moffo" (advertisement (for a biography on Anna Moffo))
- 17:49 Oct 9, 2002 Scipius deleted "Afar language" (Article talked about how Afar was causing confusion among students of Roosevelt High in Minneapolis. Nothing on the language itself, therefore junk.)
- 17:44 Oct 9, 2002 Scipius deleted "Bayer Company" (Full text: poop opium is bad 4 )
- 17:39 Oct 9, 2002 Scipius deleted "Ypres" (A bit of a test or something: Full text: Put your text for the new page here. crystal )
- 17:24 Oct 9, 2002 PierreAbbat deleted "Heian Period" (Junk by 216.231.11.130: \"no i am not goign to write stuff for u to steal\")
- 17:21 Oct 9, 2002 PierreAbbat deleted "Zhu" (junk by 216.231.11.130: \"Put your text for the new page here. ur gay and so is teh zhu dynasty casue ur not giving me any info!!!!\")
- 17:21 Oct 9, 2002 PierreAbbat deleted "Zhu" (junk by 216.231.11.130: \"Put your text for the new page here. ur gay and so is teh zhu dynasty casue ur not giving me any info!!!!\")
- 08:09 Oct 9, 2002 Andre Engels deleted "Cleisthenes" (\"Put your text for the new page here. what does it mean?\")
- 06:34 Oct 9, 2002 Jheijmans deleted "Mossel Bay" (\"Put your text for the new page here. Me Gay man\")
- 06:34 Oct 9, 2002 Jheijmans deleted "Clerks" (\"First movie by Kevin Smith.\")
- 06:34 Oct 9, 2002 Jheijmans deleted "World War II/The Blitz" (\"Help\")
- 06:33 Oct 9, 2002 Jheijmans deleted "Bridge of Sighs" (empty, prev \"sites\")
- 06:32 Oct 9, 2002 Maveric149 deleted "Syntax analysis" (pro )
- 06:07 Oct 9, 2002 Maveric149 deleted "Neon/Temp" (temp page that is no longer needed)
- 00:44 Oct 9, 2002 Maveric149 deleted "Waxhaw, South Carolina" (Put your text for the new page here. map )
- 22:31 Oct 8, 2002 Lee Daniel Crocker deleted "Natural catastrophe" (Same kid; no content or history in either page.)
- 22:30 Oct 8, 2002 Lee Daniel Crocker deleted "Ignatius Donnelly" (Just a kid playing around...)
- 21:37 Oct 8, 2002 Jheijmans deleted "Khamis Mushait" (redirect, needed for move)
- 21:35 Oct 8, 2002 Jheijmans deleted "Kleene algebra" (\"AXYZFBD AXYZFCD AXYZXYZFCD AXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZXYZFBD AXYZXYZFCD AXYZXYZFBD AXYZXYZXYZFCD AXYZXYZXYZFCD AXYZXYZXYZFCD AXYZXYZXYZFCD\")
- 21:35 Oct 8, 2002 Jheijmans deleted "Extranet" (\"Any Idea??\")
- 21:35 Oct 8, 2002 Jheijmans deleted "Young Turks" (\"Young Turks.\")
- 21:35 Oct 8, 2002 Jheijmans deleted "Motorola 68008" (\"Put your text for the new page here. gngh\")
- 21:34 Oct 8, 2002 Jheijmans deleted "Milwaukee Deep" (\"my name is rover mcrover i am in 2nd grade\")
- 21:34 Oct 8, 2002 Jheijmans deleted "Polish-Lithuanian Commonwealth" (History of Poland)
- 19:17 Oct 8, 2002 Tarquin deleted "Clifford E. Berry" (junk entry)
- 17:30 Oct 8, 2002 PierreAbbat deleted "Cockermouth" (empty orphan contained junk)
- 15:45 Oct 8, 2002 Tarquin deleted "Hiawatha" (no content)
- 15:44 Oct 8, 2002 Tarquin deleted "Mazurka" (no content)
- 10:46 Oct 8, 2002 Jheijmans deleted "Provisional Government" (empty, prev \"Gör som jag säger annars skruvar jag fast dig i bordet.\" /Jorma Hogeborn\")
- 10:37 Oct 8, 2002 Andre Engels deleted "Internet humor/Two Cows Talk" (Talk page hiding as a subpage; contents have been moved to Talk:You have two cows)
- 10:36 Oct 8, 2002 Jheijmans deleted "Romania/Temp" (temporary page)
- 10:34 Oct 8, 2002 Andre Engels deleted "Beloit College" (copyright violation; has been on Votes for deletion for a week; already taken off \'Votes for Deletion\' as an already deleted page)
- 10:31 Oct 8, 2002 Andre Engels deleted "New York City, New York/Murray Hill" (short-lived page, now only orphan redirect, deletion requested by originator)
- 10:30 Oct 8, 2002 Andre Engels deleted "New York City, New York/Harlem" (short-lived page, now only redirect, deletion requested by originator)
- 08:56 Oct 8, 2002 WojPob deleted "Motorola Coldfire" (non article, no history)
- 08:33 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with W" (\"There are no names in the Bible that start with W.\")
- 08:32 Oct 8, 2002 Jheijmans deleted "List of Biblical names starting with X" (\"There are no names in the Bible that start with X\")
- 08:31 Oct 8, 2002 Jheijmans deleted "Sympathomimetic" (\"Put your text for the new page here.theobromine\")
- 08:28 Oct 8, 2002 Jheijmans deleted "Talk:OsmosisTwo" (talk page of removed page)
- 08:28 Oct 8, 2002 Jheijmans deleted "OsmosisTwo" (nonsense page, listed on votes for deletion for some time)
- 08:27 Oct 8, 2002 Jheijmans deleted "Protea" (copyright violation, been on votes for deletion for some time)
- 08:26 Oct 8, 2002 Jheijmans deleted "Teunis de Wit" (personal page, listed on votes for deletion for some time)
- 08:26 Oct 8, 2002 Jheijmans deleted "Talk:John T. Thompson" (talk page of removed page)
- 08:26 Oct 8, 2002 Jheijmans deleted "John T. Thompson" (copyright violation, been on votes for deletion for some time)
- 08:25 Oct 8, 2002 Jheijmans deleted "Talk:Kaspar Schlick" (talk page of removed page)
- 08:25 Oct 8, 2002 Jheijmans deleted "Kaspar Schlick" (copyright violation (in German), been on votes for deletion for some time)
- 07:45 Oct 8, 2002 Maveric149 deleted "Manned space mission" (content moved. Getting this out of the way for a correct move)
- 06:53 Oct 8, 2002 Jheijmans deleted "Lost Jerusalem" (redirect, needed for move)
- 06:52 Oct 8, 2002 Jheijmans deleted "Eldridge" (redirect, needed for move)
- 06:52 Oct 8, 2002 Jheijmans deleted "Neo Jerusalem" (redirect, needed for move)
- 06:51 Oct 8, 2002 Jheijmans deleted "Aveh" (redirect, needed for move)
- 06:40 Oct 8, 2002 Maveric149 deleted "Rubber tire" (blank; junk in history)
- 06:40 Oct 8, 2002 WojPob deleted "APHMEC" (a non-article, requested)
- 06:34 Oct 8, 2002 Jheijmans deleted "Teddy Flack" (\"Put your text for the new page here.i want a picture of teddy flack \")
- 06:33 Oct 8, 2002 Jheijmans deleted "Non-zero-sum games" (\"An example of a non-zero sum game would be the classic Bean game\")
- 06:32 Oct 8, 2002 Jheijmans deleted "Description" (\"Description: words used to demonstrate the attributes of\")
- 06:25 Oct 8, 2002 Jheijmans deleted "Meet in the middle" (\"Put your text for the new page here. Haha..\")
- 06:25 Oct 8, 2002 Jheijmans deleted "Miniscule" (\"really small, insignificant, neglible\" (should be min_u_scule, anyway))
- 06:24 Oct 8, 2002 Jheijmans deleted "Joseph-Marie Jacquard" (\"he smelled like a pig donkey buttmunch.\")
- 06:23 Oct 8, 2002 Jheijmans deleted "William Bradford" (\"Put your text for the new page he\")
- 06:23 Oct 8, 2002 Jheijmans deleted "Hokkien" (\"Beautiful Country \")
- 06:23 Oct 8, 2002 Jheijmans deleted "Fad" (empty, prev \"Main Entry: fad Pronunciation: \'fad Function: noun Etymology: origin unknown Date: 1867 (etc.)\")
- 06:22 Oct 8, 2002 Jheijmans deleted "Dahab, Egypt" (empty, prev \"www.daniela-hotels.com\")
- 05:45 Oct 8, 2002 Maveric149 deleted "Argon/Temp" (temp page that is no longer needed)
- 03:18 Oct 8, 2002 Maveric149 deleted "Kristin Otto" (go to http://www.www.com !!!!its a search engine no that doesnt have anything to do with kristin otto but WHO CARE? hahahahahahahahahahahahahaha )
- 02:18 Oct 8, 2002 Brion VIBBER deleted "Hadrian's Wall" (Cut-n-paste from [[Hadrian\'s wall]]; no editing done under this capitalization. Content moved back there, need to delete this one to free up the title for renaming.)
- 01:20 Oct 8, 2002 Maveric149 deleted "Jian" (blank; junk in history)
- 01:18 Oct 8, 2002 Maveric149 deleted "Cape Town" (just a redirect; no history; need to get this out of the way for a move)
- 00:10 Oct 8, 2002 Andre Engels deleted "Berger Roy Al" (copyright violation; has been on votes for deletion for a week)
- 00:08 Oct 8, 2002 Andre Engels deleted "Anarcosocial-communism" (non-subject, moved to meta, on Votes for Deletion)
- 00:08 Oct 8, 2002 Andre Engels deleted "Loyda Morales" (No factual information; has been on votes for deletion for 1 week without dissent)
- 00:07 Oct 8, 2002 Andre Engels deleted "Bonneville Apartments" (looks like an advertisement, has been on Votes for Deletion for 1 week without dissent)
- 23:56 Oct 7, 2002 Maveric149 deleted "London College of Fashion" (The London College of Fashion should be listed under The London Institute. )
- 23:44 Oct 7, 2002 Maveric149 deleted "Mustard agent" (Put your text for the new page here.jhnikjikml;koklp[iu8uiureua9g8qwtnqertijirGJIRJGIJIAERFDARijijsejixjijijiwejgjgirjegiijijijseXJJJIJGIJIREGIGR )
- 23:42 Oct 7, 2002 Maveric149 deleted "Pacific loon" (http://www.birdphotography.com/ )
- 23:08 Oct 7, 2002 Maveric149 deleted "Party congress of the CPSU" (junk; hey guess what im copyrited and you aren tonitng )
- 23:03 Oct 7, 2002 Maveric149 deleted "Law of Canada" (junk; Put your text for the new page here. history of canadian criminal law )
- 22:14 Oct 7, 2002 Lee Daniel Crocker deleted "WINE" (Preparing for move...)
- 21:34 Oct 7, 2002 Tarquin deleted "Madame Grey" (just daft text)
- 17:51 Oct 7, 2002 Jheijmans deleted "Luxembourg/Temp" (temporary page)
- 15:04 Oct 7, 2002 PierreAbbat deleted "S’Archittu" (Junk by 151.29.72.97. Just weblink. Deleted for at least the second time.)
- 14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons (temp)" (temp page)
- 14:22 Oct 7, 2002 Tarquin deleted "Dungeons & Dragons" (making room for move)
- 14:10 Oct 7, 2002 Jheijmans deleted "Nagoya" (getting out of the way for move)
- 13:38 Oct 7, 2002 PierreAbbat deleted "S’Archittu" (title contains weird character; content is only web links)
- 13:27 Oct 7, 2002 Jheijmans deleted "Talk:North Brabant/Temp" (talk page of temporary page - contents moved)
- 13:27 Oct 7, 2002 Jheijmans deleted "North Brabant/Temp" (temporary page)
- 13:24 Oct 7, 2002 WojPob deleted "Defence Intelligence Agency" (spelling wrong, I\'m an idiot)
- 11:06 Oct 7, 2002 Tarquin deleted "Mole (espianoge)" (just babble)
- 10:33 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg" (I thought I already did this one - copyright image)
- 10:32 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png" (I thought I already did this one - replaced by sulfanilamide2.png)
- 10:29 Oct 7, 2002 Andre Engels deleted "Image:Pistols.jpg" (copyrighted)
- 10:27 Oct 7, 2002 Andre Engels deleted "Image:Sulfanilamide.png" (has been replaced by sulfanilamide2.png)
- 07:57 Oct 7, 2002 Isis deleted "Beverly K Effinger" (mistakenly created w/out period on title initial)
- 07:54 Oct 7, 2002 Jheijmans deleted "Guido Carli" (empty, prev \"Put your text for the new page here. wwwc f df e ret fg ert et gf et e fg rg fg\")
- 06:59 Oct 7, 2002 Jheijmans deleted "Djibouti/Temp" (temporary page)
- 06:57 Oct 7, 2002 Maveric149 deleted "Zebulun Kurth-Nelson" (orphan, contents moved to meta; Content moved to m:Zebulun Kurth-Nelson. )
- 06:53 Oct 7, 2002 Maveric149 deleted "Clark Prensoil Potter" (just a link to meta: see m:Clark Pernsoil Potter )
- 06:52 Oct 7, 2002 Maveric149 deleted "Spoken game" (just a link to another article; \"improvisation\" )
- 06:32 Oct 7, 2002 Jheijmans deleted "Airglow" (empty, prev \"Put your text for the new page here. i have no fucking clue\")
- 06:32 Oct 7, 2002 Jheijmans deleted "Interjection" (empyt, prev \"BullShit - founded in 1948\")
- 06:31 Oct 7, 2002 Jheijmans deleted "Babington Conspiracy" (\"a\")
- 06:31 Oct 7, 2002 Jheijmans deleted "Executive department" (\"this is the executive branch.\")
- 06:30 Oct 7, 2002 Jheijmans deleted "Second Athenian Empire" (\"www.new-revo.com !! You love it!\")
- 06:30 Oct 7, 2002 Jheijmans deleted "Stirrer" (\"Put your text for the new page here.;pl\")
- 05:53 Oct 7, 2002 WojPob deleted "Chinese grammar" (no content, no history, deleted)
- 04:26 Oct 7, 2002 Maveric149 deleted "Sexual perversion" (hello )
- 01:50 Oct 7, 2002 Andre Engels deleted "Walter Benjamin" (\" Put your text for the new page here. bbuhjbhubhuuuuuuuuuuuuuuuubuhuuuuuuuuuuuuuuuuuuuuuuuuu\")
- 01:48 Oct 7, 2002 Andre Engels deleted "Canandaigua, New York" (\"can you tell me , where i came a hold of a copy 1830 census for the township of candaigua or the the address of your library fir this townshio dan gallez ddg65@aol.com\")
- 01:45 Oct 7, 2002 Andre Engels deleted "One-party system" (\"Hey whatssup\")
- 01:34 Oct 7, 2002 Stephen Gilbert deleted "Logos and slogans" (my mistake)
- 23:43 Oct 6, 2002 Maveric149 deleted "Rod Carew" (nonarticle; \"Rod Carew was good at playing games. He also was a huge asshole. \")
- 23:40 Oct 6, 2002 Maveric149 deleted "Central heating" (Newbie experiment; \"HI my name is joe \" Hello Joe! Visit the help button on the top of your page to see what the project is about)
- 23:36 Oct 6, 2002 Maveric149 deleted "Internet service provider" (need to get this out of the way for a move)
- 21:50 Oct 6, 2002 Tarquin deleted "National Trust (England, Wales and Northern Ireland) properties" (new page; content moved elsewhere; deletion requested by Nevilley)
- 21:45 Oct 6, 2002 Tarquin deleted "Parse tree" (no intelligible content)
- 19:56 Oct 6, 2002 Jheijmans deleted "Ellobiopsids" (\"kevin michael allesee is the coolest\")
- 19:56 Oct 6, 2002 Jheijmans deleted "Spoken game" (improvisation)
- 19:55 Oct 6, 2002 Jheijmans deleted "Olga Pyleva" (\"Put your text for the new page here.Olga\")
- 19:55 Oct 6, 2002 Jheijmans deleted "New Ipswich, New Hampshire" (\"Rickard F\")
- 19:55 Oct 6, 2002 Jheijmans deleted "A00 Sokolsky Opening 1.e4 e5" (delete requested by initiaor of page)
- 11:08 Oct 6, 2002 Maveric149 deleted "Krypton/Temp" (temp page that is no longer needed)
- 10:32 Oct 6, 2002 WojPob deleted "Tezpur, Assam" (no content, no history, deleted)
- 10:30 Oct 6, 2002 WojPob deleted "Stephen King/Dolans Cadillac" (no content, no history, deleted)
- 07:36 Oct 6, 2002 Koyaanis Qatsi deleted "Not Black supremacy" (\"Put your text for the new page here. uhm...yea...you suck \")
- 07:17 Oct 6, 2002 Jheijmans deleted "Mythology of demons" (empty, \"yo here is what i say fuck off le let me stay\")
- 07:16 Oct 6, 2002 Jheijmans deleted "Babington Conspiracy" (empty, \"you shouldn\'t allow people to edit these pages\" )
- 07:15 Oct 6, 2002 Jheijmans deleted "Diplomonads" (\"lick my balls\" )
- 07:15 Oct 6, 2002 Jheijmans deleted "Moose Jaw" (\"31000 POPULATION\" )
- 07:15 Oct 6, 2002 Jheijmans deleted "1 E21 m" (\"girth of my wang\" (by user Hfastedge?))
- 07:14 Oct 6, 2002 Jheijmans deleted "Florianus" (eh? )
- 21:37 Oct 5, 2002 Brion VIBBER deleted "Junk page that is being deleted to confirm bug is fixed" (Deletion log time zone bug)
- 23:15 Oct 5, 2002 WojPob deleted "Mass Production" (no content, no history, removed)
- 09:51 Oct 5, 2002 Maveric149 deleted "Helsinki" (getting this out of the way for a move; just a redirect)
- 14:13 Oct 5, 2002 The Epopt deleted "C-46 Commando" (copyright violation)
- 14:13 Oct 5, 2002 The Epopt deleted "C-47 Skytrain" (copyright violation)
- 14:29 Oct 5, 2002 Scipius deleted "Das Kapital" (Full text: moon boom)
- 06:19 Oct 5, 2002 Maveric149 deleted "Human" (just a redirect; no history; need to get this out of the way for a move)
- 06:17 Oct 5, 2002 Maveric149 deleted "Humans" (just a redirect, has never been anything else; need to get this out of the way for a complicated move)
- 13:10 Oct 5, 2002 Scipius deleted "Testingwhetherthereisalimittothelengthsofpagenamesddlskdlaskdnvlknancsklnasnfdoaiwnrpiwnrpqnrpqwnrpiqnneifniqnfiqwnipqwnfiqwnfiqwnfpiwqnfpinfipqnfipqwnfipnqwfpniwnfqpmmqcpomowmcmcopqwmpowcmopqwmcoqwpmcowpqmcopqmwcopwmcopmqcwopmcopqmwocpmwocmopcwqmopwqmcop" (Lir was testing the pagename length)
- 19:26 Oct 4, 2002 Maveric149 deleted "Wikipedia:Tom Tommorrow" (orphan, made my mistake)
- 21:44 Oct 4, 2002 Tarquin deleted "Coppicing/pollarding" (new page; already moved to better title)
- 22:58 Oct 4, 2002 Ed Poor deleted "SPIHT" (graffiti)
- 20:35 Oct 4, 2002 Jheijmans deleted "Horace de Saussure" (\"Put your text for the new page\")
- 20:35 Oct 4, 2002 Jheijmans deleted "Cisternae" (\"ur a dork and a half.\")
- 20:35 Oct 4, 2002 Jheijmans deleted "Israeli Security Zone" (empty, prev \"hola it\'s me\'s again ha ha ha ha.\")
- 20:35 Oct 4, 2002 Jheijmans deleted "United Nations Partition Plan" (empty, prev \"hola chicos, and chicas. me just a normal school kid at school. i don\'t know what i\'m doing so audios\")
- 17:39 Oct 4, 2002 Koyaanis Qatsi deleted ".phtml" (total content == \"Yo wazzup! Nothin\' here. Surf somewhere else. LOL ROTFL\", no pages linking to it, possiblly created to attempt some kind of exploit)
- 18:43 Oct 4, 2002 Ed Poor deleted "State sponsors of terrorism" (created this redirect page by mistake)
- 17:43 Oct 4, 2002 Jheijmans deleted "Ghent" (getting out of the way for move)
- 12:55 Oct 4, 2002 Andre Engels deleted "Pearson Hashing" (newbie test)
- 12:37 Oct 4, 2002 Andre Engels deleted "Duck duck goose" (\"The only game yet created where the winner, indeed, becomes the duck\")
- 12:05 Oct 4, 2002 Jheijmans deleted "Exchange rate" (\"Put your text for the new page here.ppp\")
- 11:10 Oct 4, 2002 Andre Engels deleted "Red Sonja" (Wikipedia is not a link depository (\"Read the review <a class=encyclopedia href=\"http://www.thespinningimage.co.uk/cultfilms/displaycultfilm.asp?reviewid=265\">here.</a>\"))
- 11:07 Oct 4, 2002 Andre Engels deleted "Johan Helsingius" (\"A big guy with tiny balls\")
- 11:01 Oct 4, 2002 Andre Engels deleted "I didn't change anything!" (phrase not characteristic enough to warrant an encyclopedia entry; been put on \'Votes for deletion\' by Jeronimo qabout 2 weeks ago)
- 08:54 Oct 4, 2002 Jheijmans deleted "Emotional punditry" (redirect, needed for move)
- 08:54 Oct 4, 2002 Jheijmans deleted "Environmental wacko" (redirect, needed for move)
- 08:51 Oct 4, 2002 Jheijmans deleted "StarEdit" (redirect, needed for move)
- 08:49 Oct 4, 2002 Jheijmans deleted "Thames/pollution" (\"Just an empty page at the moment.\")
- 08:45 Oct 4, 2002 Jheijmans deleted "Ekumen" (redirect, needed for move)
- 08:44 Oct 4, 2002 Jheijmans deleted "The Dispossessed" (redirect, needed for move)
- 08:34 Oct 4, 2002 Jheijmans deleted "Vitamin E familial isolated, deficiency of" (copyright violation, been on votes for deletion for some time)
- 08:34 Oct 4, 2002 Jheijmans deleted "Clara Thrupp" (\"She was born on the 1st July 1992. She has been in some school plays. One of her most famous roles was as a vogue dancer and in the choir. \" listed on votes for some time)
- 08:33 Oct 4, 2002 Jheijmans deleted "Eric Hoffman" (personal page about a family member of a user (Grouse). \"contents\" already on that page.)
- 08:32 Oct 4, 2002 Jheijmans deleted "Talk:Belief" (talk page of removed page)
- 08:32 Oct 4, 2002 Jheijmans deleted "Belief" (no contents, been on votes for deletion for some time)
- 08:31 Oct 4, 2002 Jheijmans deleted "Carol" (copyright violation, been on votes for deletion for some time)
- 08:29 Oct 4, 2002 Jheijmans deleted "Dinant" (\"Put your text for the new page here. Dinantee\")
- 08:29 Oct 4, 2002 Jheijmans deleted "Stevertigo" (\"i can be emailed at stevertigo@nupedia.com\")
- 08:29 Oct 4, 2002 Jheijmans deleted "Secret key" (\"testing one two three\")
- 08:29 Oct 4, 2002 Jheijmans deleted "Dorchester, England" (\"An English place\")
- 08:29 Oct 4, 2002 Jheijmans deleted "G3" (\"Banas\")
- 08:28 Oct 4, 2002 Jheijmans deleted "Philosophical Investigations/family resemblance" (empty, prev \"When the bird meets the bee, you lookalike both the bird and bee. Logically it can be expressed a=b=ab. In this way, you lookalike the rest of your clan.\")
- 08:28 Oct 4, 2002 Jheijmans deleted "Aswan High Dam" (empty, prev \"khbkjgabkjglkjdfjgljdhgl;ihuitkjkgjbdkjfvbbvkjdbvbjkbjkbvkdbvkvbskjvbv kjbbiufdbv\")
- 08:28 Oct 4, 2002 Jheijmans deleted "U.s. presidental election, 1948" (empty, prev \"The election of 1948 was considered by far the most fucked up of them all (cont.)\")
- 08:27 Oct 4, 2002 Jheijmans deleted "Sunset" (empty, prev \"LASER (repeated a lot of times)\" )
- 08:27 Oct 4, 2002 Jheijmans deleted "TWA 847 hijacking" (empty, no previous contents)
- 06:22 Oct 4, 2002 Brion VIBBER deleted "Green economics" (History is a series of redirects and a cut-n-paste from Green economist. Deleting to make room for rename of that page in this page.)
- 08:18 Oct 4, 2002 WojPob deleted "Howdoudeleteapage" (no significant history, deleted)
- 23:58 Oct 3, 2002 Brion VIBBER deleted "Green Economism" (Cut-n-paste move from Green economist; no actual editing history. Text has been moved back there, need to remove to make room for potential rename)
- 19:15 Oct 3, 2002 Jheijmans deleted "Existentialism/Old" (old text, copied to talk)
- 18:27 Oct 3, 2002 Jheijmans deleted "Toe" (\"Toe: a finger like object that grows off the foot.\")
- 18:26 Oct 3, 2002 Jheijmans deleted "Electrostatic field" (\"Put your text for the new page here. ciao\")
- 18:25 Oct 3, 2002 Jheijmans deleted "Henri Désiré Landru" (\"PLEASE FILL THIS IN!\")
- 18:24 Oct 3, 2002 Jheijmans deleted "Marcel Petiot" (\"hello i am alex\")
- 10:27 Oct 3, 2002 Brion VIBBER deleted "Santa Cruz Operation" (Cut-n-paste from SCO, no history; needs to be deleted to make room for a proper rename)
- 12:16 Oct 3, 2002 Jheijmans deleted "Adzuki bean" (\"Adzuki bean\")
- 11:48 Oct 3, 2002 Jheijmans deleted "Obfuscating software" (\"asdfasdf\")
- 10:28 Oct 3, 2002 Tarquin deleted "Hazaed (game)" (name with typo)
- 11:19 Oct 3, 2002 Jheijmans deleted "Brazil's anthem, entitled Hino Nacional Brasileiro" (poorly title and \"HIOugpgu\" as content)
- 09:10 Oct 3, 2002 Jheijmans deleted "San Marino/Temp" (temporary page)
- 09:01 Oct 3, 2002 Jheijmans deleted "Seth Howard" (already on meta)
- 09:01 Oct 3, 2002 Jheijmans deleted "Weak entity" (\"hello\")
- 09:00 Oct 3, 2002 Jheijmans deleted "Philip III of Spain" (\"Philip III of Spain. hi!!!!\")
- 08:58 Oct 3, 2002 Jheijmans deleted "Charles Spurgeon" (copyright violation, been on votes for deletion for some time)
- 08:57 Oct 3, 2002 Jheijmans deleted "Hans Eijsackers" (copyright violation, been on votes for deletion for some time)
- 08:57 Oct 3, 2002 Jheijmans deleted "Morals or Ethics" (already on meta)
- 08:56 Oct 3, 2002 Jheijmans deleted "Curved Air" (copyright violation, been on votes for deletion for some time)
- 08:56 Oct 3, 2002 Jheijmans deleted "Bad Religion" (copyright violation, been on votes for deletion for some time)
- 08:55 Oct 3, 2002 Jheijmans deleted "Pcl" (\"Dit is een test van Jan-WIllem\")
- 08:55 Oct 3, 2002 Jheijmans deleted "Meersburg" (\"http://www.mainau.de/\")
- 08:54 Oct 3, 2002 Jheijmans deleted "Mainau Island" (\"http://www.mainau.de/ \")
- 08:54 Oct 3, 2002 Jheijmans deleted "Hugh Richardson" (\"hee hee hee hee\")
- 08:53 Oct 3, 2002 Jheijmans deleted "Andraé Crouch" (empty, prev \"I would like to edit this, if only I knew what to do...lol\")
- 08:53 Oct 3, 2002 Jheijmans deleted "Battle of Lexington and Concord" (empyt, prev \"what did the blind man say as he walked past the tuna factory?\")
- 08:52 Oct 3, 2002 Jheijmans deleted "Flight AF 8969 Alger-Paris hijacked" (empyt, prev \"your mom hijacked a plane but she was too fat to fit into a seat and it crashed anyway... \")
- 08:50 Oct 3, 2002 Jheijmans deleted "University of Kiel" (empyt, prev \"A university of Phsycokenises in Northern Germany\")
- 08:50 Oct 3, 2002 Jheijmans deleted "Yang di-Pertuan Agong" (empyt, prev \"king\")
- 23:48 Oct 2, 2002 Maveric149 deleted "Predicate calculus" (junk \" Put your text for the new page here.ggbvbvbvbbvbvbvbvbvbvbv \")
- 23:46 Oct 2, 2002 Maveric149 deleted "Radon/Temp" (temp page that is no longer needed)
- 19:47 Oct 2, 2002 PierreAbbat deleted "Battle of Lutzen" (useless non-article just says \"Lutzen\")
- 19:45 Oct 2, 2002 PierreAbbat deleted "Talk:Electronic filter" (garbage left long ago by a passing IP: \" Its wikkid, www.horlix.com\")
- 19:15 Oct 2, 2002 PierreAbbat deleted "Blue Gene" (garbage by 65.58.149.45; only content: \"FUCK FUCK FUCK\")
- 01:43 Oct 3, 2002 Andre Engels deleted "Roman emperor" (created this as a redirect to a page I thought existed but didn\'t)
- 22:00 Oct 2, 2002 Brion VIBBER deleted "Peasants' Revolt" (Junk comment, was recommended for deletion, need to take it out to make room for renaming better already existing article)
- 23:29 Oct 2, 2002 Andre Engels deleted "Port Royal" ( this is pathetic you dont even have info!! hello???)
- 22:04 Oct 2, 2002 Tarquin deleted "Antiwikipedic"
- 21:47 Oct 2, 2002 Tarquin deleted "Antiwikipedic" (no, it\'s already been agreed that this page belongs on the Meta site. If I\'m mistaken, please let me know on my talk page. And besides, you shouldn\'t create pages with no content)
- 21:40 Oct 2, 2002 Tarquin deleted "Antiwikipedic" (hello, goodbye)
- 22:43 Oct 2, 2002 -- April deleted "Antiwikipedic" (Exists on meta.)
- 22:27 Oct 2, 2002 -- April deleted "Antiwikipedic" (Article is on meta /and/ Wikipedia namespace. Doesn\'t belong here. )
- 20:28 Oct 2, 2002 -- April deleted "Antiwikipedic" (Not a word. Page exists on meta. IP blocked.)
- 20:24 Oct 2, 2002 -- April deleted "Antiwikipedic" (Not a word. Page exists on meta.)
- 20:09 Oct 2, 2002 -- April deleted "Wikipedic" (Page exists on meta, where it belongs. Use m:Wikipedic to reference.)
- 20:08 Oct 2, 2002 -- April deleted "Wikipedia: Antiwikipedic" (Page exists on meta, where it belongs.)
- 20:07 Oct 2, 2002 -- April deleted "Antiwikipedic" (Page exists on meta, where it belongs.)
- 19:52 Oct 2, 2002 -- April deleted "Antiwikipedic" (This is not a forum for creating terms. Place on meta or in wikipedia: namespace.)
- 15:54 Oct 2, 2002 Koyaanis Qatsi deleted "Antiwikipedic" (this page is not encyclopedic material. wikipedia is not the place to coin a term or post original research)
- 15:43 Oct 2, 2002 Koyaanis Qatsi deleted "AntiWikipedic" (deleted. not in error.)
- 00:42 Oct 3, 2002 Stephen Gilbert deleted "Stephen Gilbert" (old, orphaned user page redirect)
- 00:32 Oct 3, 2002 Stephen Gilbert deleted "STG" (my old sig redirect, now an orphan)
- 17:01 Oct 2, 2002 Andre Engels deleted "Laurasia" (Full text: \"hello?\")
- 16:52 Oct 2, 2002 Andre Engels deleted "CTSS" (I was just wondering what CTSS is and thought if I clicked that link I would find my answer. )
- 16:17 Oct 2, 2002 Jheijmans deleted "Maurice" (\"huh?\")
- 14:01 Oct 2, 2002 Andre Engels deleted "Riptor's articles" (recently created User page; moved to User:Riptor/Riptor\'s articles)
- 09:20 Oct 2, 2002 Jheijmans deleted "Transaction processing" (\"JKJKJKJ\")
- 09:08 Oct 2, 2002 Jheijmans deleted "In Vitro Fertilisation/Todo" (obsolete subpage, contents in talk)
- 08:50 Oct 2, 2002 Andre Engels deleted "Global warming/Todo" (Old /Todo page; content has been copied to Global warming:Talk)
- 08:45 Oct 2, 2002 Jheijmans deleted "Fuller Theological Seminary" (\"http://www.fuller.edu\" )
- 08:23 Oct 2, 2002 Jheijmans deleted "Pseudorandom" (\"Put your text for the new page here. New page test\")
- 08:22 Oct 2, 2002 Jheijmans deleted "Vaux-le-Vicomte" (\"pussy?\")
- 08:21 Oct 2, 2002 Jheijmans deleted "Ann Theresa de Keersmaker" (empty, prev \"hoi\")
- 23:21 Oct 1, 2002 Maveric149 deleted "Barney Rubble" (off topic and slang usage to boot \" In England the term Barney is used against someone who is not a babe, but rather unattractive. \")
- 23:00 Oct 1, 2002 Maveric149 deleted "Ned Ludd" (junk \" douchebag \")
- 23:00 Oct 1, 2002 Maveric149 deleted "Self-starvation" (junk \" tyujjjj \")
- 22:57 Oct 1, 2002 Maveric149 deleted "Middle High German" (newbie experimenet \" hello \" Hi there)
- 22:54 Oct 1, 2002 Maveric149 deleted "Aeolic" (nebie experiment; \" hello there how are you? \" I\'m fine )
- 22:53 Oct 1, 2002 Maveric149 deleted "Oliver Ellsworth" (junk \" Put your text for the new page here. Wassup foos \")
- 22:52 Oct 1, 2002 Maveric149 deleted "HMAS Darwin" (removed website ad)
- 22:52 Oct 1, 2002 Maveric149 deleted "Chemical burn" (rubbish; \" Can cause up to 4th degree burns \" so can many other things)
- 22:51 Oct 1, 2002 Maveric149 deleted "Fluoride" (junk \" It\'s not a yummy substance...uck!! \")
- 18:57 Oct 1, 2002 Andre Engels deleted "Stem cell/Todo" (/Todo page from November last year. The actual text on the page has been moved to Talk:Stem cell)
- 01:06 Oct 2, 2002 Stephen Gilbert deleted "Wikipedia talk:What Google Likes" (deleting my dumb mistake)
- 09:57 Oct 1, 2002 Tarquin deleted "Guiness Book of World Records" (new page created with just offensive comment)
- 10:39 Oct 1, 2002 Jheijmans deleted "Peat bog" (empty, prev \"Hi, a peat bog is i don\'t know what\")
- 09:50 Oct 1, 2002 Jheijmans deleted "Ashtanga Yoga" (\"Brutal spankings.\")
All Wikipedia text
is available under the
terms of the GNU Free Documentation License